(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE165

PENCW_16.PE165       Location/Qualifiers
FT   CDS_pept        join(complement(373601..373693),complement(373047..373528),
FT                   complement(372863..372992))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181024" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128696"
FT                   /orf_name="Pc20g01650"
FT                   /product="Pc20g01650 protein"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /biological_process="porphyrin biosynthetic process "
FT                   /protein_id="CAP85494.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006779"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00018313A8"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDQ0"
FT                   /transl_table=1
FT                   /translation="MSKFPEVQGGGSLIIAWQIRDKHVLVVGGGEVAAGRILHALNADA
FT                   RVTVVCPAAGLNEEVNFRVTEKQVTHIDRNFEPSDLDNVDMVLCAIDDPEASTQVWKLC
FT                   KERRIIANIADVPPECDFYFGSVHRDGPLQVMVSTNGNGPKLASIVRKKISETLPTNMG
FT                   AAIENVGKLRKKLREVAPNPDQGPKRMKWMSGVCETWSLDELVQMTEEDMDSVLSFYES
FT                   GKIPALEEVRNK"
     atgtcaaagt tcccagaagt acaaggtgga ggttcgttga taatcgcttg gcaaattaga        60
     gacaagcatg tgctagtcgt aggtggtgga gaggtcgctg caggacgcat cctccacgct       120
     ctcaatgccg atgcccgggt cactgtggtt tgtccagccg ctggactaaa tgaagaagtc       180
     aatttcagag tgacagaaaa gcaagtcacc cacattgatc gaaactttga gccatccgac       240
     ctcgataatg tggacatggt gctctgtgcc atcgacgacc cggaggcttc aacacaagtc       300
     tggaaactct gcaaggagag acggattatt gccaacatcg ctgatgtccc acctgaatgt       360
     gacttctatt ttgggagtgt tcaccgcgat gggccattgc aggtcatggt cagcacaaat       420
     gggaacgggc ccaagctagc tagcattgtg cgcaagaaga tctcggagac tttgccaacg       480
     aacatggggg cagcgattga gaatgtggga aagctacgga agaagctccg ggaggttgcg       540
     ccgaatcctg accaaggccc caagagaatg aaatggatgt ctggtgtctg cgaaacatgg       600
     agcctcgatg agcttgtaca gatgaccgaa gaggacatgg acagcgtatt atccttttac       660
     gagtcgggta agatcccagc tctagaggaa gtacggaata aataa                       705
//

If you have problems or comments...

PBIL Back to PBIL home page