(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE167

PENCW_16.PE167       Location/Qualifiers
FT   CDS_pept        join(378412..378544,378687..378976)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947766"
FT                   /orf_name="Pc20g01670"
FT                   /product="Pc20g01670 protein"
FT                   /protein_id="CAP85496.1"
FT                   /db_xref="UniParc:UPI00018313AA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDQ2"
FT                   /transl_table=1
FT                   /translation="MANQCSGHVFAIVQATNGNILTWRCSDCNSGPFVAIWRCKICGHY
FT                   ICICFLSISSTDLLLCMNPVQGYFPLGAGLPAHFVAFVWRVFVHLMCSKSPQKFLMHLH
FT                   LASGGVIDRFPPPLSHSSYSLFYYGYVFYILDLDFP"
     atggccaacc aatgttccgg tcacgtcttt gccattgtcc aggctaccaa tggcaacatt        60
     ctgacctggc gctgctccga ctgcaactct ggaccctttg tggctatctg gcgctgcaag       120
     atctgtggtc attacatttg catttgcttt cttagcattt ccagcactga tctactgctc       180
     tgcatgaacc ctgtgcaagg gtacttcccc cttggagctg gattacccgc tcacttcgtg       240
     gccttcgttt ggcgtgtgtt tgtgcatttg atgtgttcca aaagtcccca aaagtttctg       300
     atgcacttgc atctcgcatc tggaggagtt atagaccgtt tccccccccc tctttcccat       360
     tcttcttatt ctttgtttta ttatggatat gtattctaca ttctggatct ggatttccct       420
     tag                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page