(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE17

PENCW_16.PE17        Location/Qualifiers
FT   CDS_pept        51962..53227
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000187686" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977328"
FT                   /orf_name="Pc20g00170"
FT                   /product="Pc20g00170 protein"
FT                   /protein_id="CAP85346.1"
FT                   /db_xref="UniParc:UPI0001831909"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF28"
FT                   /transl_table=1
FT                   /translation="MASPSKAAGAAAAAAAIASSAAETVVQTSGSPETSSETSAAQPST
FT                   SSTETTSSSAPAPTTSSSTEPTTTSSTTSSTSSTPTTEPTTSTPDPTSTSPTSTSTSST
FT                   SSSTSSTSSTSSTTTAPSTTSSEEKTTFTSTEGTTVVVVTSTQIASNTGATSTTSSSAT
FT                   DSAALATSGTAAGSGGLSPSGTIAVAVVVPVVSVALIILALLFFWRKRKANKAAEEERR
FT                   KEVEEYGFNPNNDPTLPGIGGVVVPKDDESSGYRGWGTTSAGRKASTNLSSGMGGLAMS
FT                   EGSSPGYHHAATPSEGTVQYSDGARPDSGEIVEPIGVLGAAPVAANNRNGDIHRGPSNA
FT                   SSAYSAANRSDASEESHMSAVHPSAGYYGENPYYGDINTHGAYGGDDYQPVIRDVQARR
FT                   NTRIENPGVYPRQGNAGIAQNF"
     atggcctccc catccaaagc cgctggcgcc gccgctgccg ctgcagctat cgcttctagc        60
     gctgcggaaa ctgttgtaca gacttcgggg tctcctgaga ccagcagtga aacatctgcc       120
     gcccaaccct ccacctcttc taccgaaacg acctcttcgt ctgcgcctgc tcccaccacc       180
     tctagttcaa ctgagccaac taccaccagt tccaccacga gcagtactag tagcacgccc       240
     acgaccgagc ctaccacgtc gacccccgac cctacgtcta cttcgcccac ttccacttcc       300
     acttcgtcta cttcttcttc cacctcttct acctcttcca cctcttctac tacaaccgca       360
     ccatccacca cctcaagtga ggagaagaca acatttacat cgacagaggg aactaccgta       420
     gttgttgtca cgtccaccca aatagcgtct aacaccggtg ccacgtctac cacctcttcc       480
     agtgcaactg attcagccgc gctcgcaacc tccggcacag cagcaggatc cggcggtctt       540
     tctcctagcg gcacaattgc cgttgcagtt gttgttccgg ttgtctcagt ggcattgatc       600
     atcttggcgc tgctcttctt ctggcgtaag cgcaaggcca acaaggcggc cgaggaggag       660
     cgtcgcaaag aagtggagga gtacggattc aacccgaaca acgacccaac ccttcccggt       720
     atcggaggcg tcgtggttcc caaggatgac gaatcctccg gctaccgcgg ctggggaacc       780
     acctctgctg ggcgcaaggc gtccaccaac ctctccagtg gaatgggtgg cctggccatg       840
     tcggaaggaa gcagccccgg ttatcaccac gccgcaacac ccagcgaagg caccgttcaa       900
     tattctgatg gcgcccgccc cgactctggc gagattgttg aacccattgg cgtgctgggt       960
     gccgccccag tggctgcgaa caaccgcaac ggcgacattc accgtggccc ctccaatgca      1020
     tcctccgctt actccgcagc caaccgttcc gacgcatcag aggaaagtca catgtccgct      1080
     gtccacccct cagctggcta ctacggtgag aacccgtact acggcgacat caacacacac      1140
     ggcgcatacg gcggagatga ctatcagcct gtgatccgtg atgtccaggc gcgccgcaat      1200
     acccgcatcg agaaccccgg tgtttatcca cgacagggga atgccggtat cgcgcagaac      1260
     ttctga                                                                 1266
//

If you have problems or comments...

PBIL Back to PBIL home page