(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE173

PENCW_16.PE173       Location/Qualifiers
FT   CDS_pept        join(394968..395480,395537..395915,395972..396160,
FT                   396333..396394,396460..396651)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234672" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947769"
FT                   /orf_name="Pc20g01730"
FT                   /product="Pc20g01730 protein"
FT                   /protein_id="CAP85502.1"
FT                   /db_xref="UniParc:UPI00018313B0"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDQ8"
FT                   /transl_table=1
FT                   /translation="MASSSAPSLANLAFDEICRQLEVFVAGKKASASFVCGGLVPIDAH
FT                   TAASSIPSKTTVSPPVRICWRTDADNILRELTLPLDSQADSKAESGLRQLVVDCEPASF
FT                   GKGQQDVLDPKYRKAGKLEPRSFLTSFHPSDLGILQNVEQILLPNFNTDLENRLPFRKM
FT                   HAELYKLNVYSGPSGLFRKHVDTPRSETQIGSLVVCLPSHFKGGNLVVQHEGKRVEFDW
FT                   SHQSASAIQWAAFYSDCEHEIKTITEGERITLTYNLYVTEPVGGSIPPSLIVDPKSMSL
FT                   YSFLEELLVEPGFMTDGGALGFFCSHAYPHASDEAPMLLPRALKGSDLVLYSVFKSLGI
FT                   QIDVLPVAFDDHYDQCKEKHVLVGDQLHPYFATDEIEEDESMTELCFPGEYRPEITWIG
FT                   SPTHRQEAVSYIAYGNQPSLGAVYSYAALIANIPPFLERQGLVLA"
     atggcttctt cttcggctcc atcattggct aacctggcgt tcgatgaaat ttgtcgtcag        60
     ctggaggtat tcgttgctgg gaaaaaagcg tctgcgtcgt ttgtttgtgg aggcctcgtc       120
     cctattgatg cgcacaccgc agctagttcc ataccatcca aaacgaccgt gtctccgcca       180
     gtgaggatct gctggcgaac agatgctgac aatatcctgc gagagttgac tctacctctt       240
     gactcacagg ccgactccaa agctgaatct ggtttgcgtc aattggtagt agactgcgaa       300
     cctgctagct ttggcaaggg acagcaagat gttcttgatc ccaaataccg aaaagctgga       360
     aagctcgagc ctcgaagttt tctcaccagc ttccacccat cagaccttgg gatccttcaa       420
     aacgtggagc aaattctcct tccaaacttc aacacagact tggaaaaccg tctacccttc       480
     cgaaaaatgc atgctgagtt atacaaactg aatgtttact cgggaccatc cggtcttttc       540
     cggaagcatg ttgacacacc gcggtccgag acccagatcg gctcactcgt cgtttgtcta       600
     ccctctcatt tcaaaggggg caacttggtc gttcaacatg agggaaaacg ggtcgagttt       660
     gactggagtc accagagtgc gtctgcgatc caatgggcag cattttacag tgactgcgag       720
     catgagatca aaacaatcac agaaggagag cgcatcacct tgacgtacaa cctctatgta       780
     acagagccag tggggggatc aattccgcca agcttgattg ttgacccaaa gagcatgtcc       840
     ttgtatagct ttttggaaga acttctcgtg gagcctggct tcatgacaga cggtggcgct       900
     ttggggttct tttgctctca cgcttatcct cacgcatccg atgaggctcc aatgctactt       960
     ccgagagcac tcaaggggtc tgatcttgtg ctttactctg ttttcaagtc tcttggaata      1020
     caaattgatg tccttcccgt ggcttttgat gatcattatg atcaatgcaa ggaaaaacat      1080
     gtgctcgtcg gagaccagct acatccgtac tttgcgactg acgagattga agaggatgaa      1140
     agtatgaccg agctgtgttt tccgggcgag tataggccgg aaatcacatg gatcggctct      1200
     ccaacacaca gacaggaggc cgtttcctat atagcttatg gaaaccaacc ttcactaggg      1260
     gcagtgtact cttatgcagc gctgatagcc aatatcccac cattcctaga gcgacaaggg      1320
     cttgttttgg cgtga                                                       1335
//

If you have problems or comments...

PBIL Back to PBIL home page