(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE175

PENCW_16.PE175       Location/Qualifiers
FT   CDS_pept        join(398358..398414,398469..398987,399067..399201,
FT                   399283..400032)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947771"
FT                   /orf_name="Pc20g01750"
FT                   /product="Pc20g01750 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP85504.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0001831488"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDR0"
FT                   /transl_table=1
FT                   /translation="MPGVPSSRGCDACRKVKKKCDQLKPTCSRCARLKMTCVGGGQQRY
FT                   MFKNQSVKAMQTQSGAESQSQLQQSFPSTGNRAVWIGKPTRVPSTDTSKMAAAFVAAFQ
FT                   VTDIRYAMAYYGPFLRDIPRRLGNSTVLDSAVRALSTAYSLLHAGSYPPKALVLYGQSL
FT                   RALRECLNDPVEARTPNTLCAVYLITICQSWLGKHDDSLTSHSEAIAHLLRAAALHEWK
FT                   STFEMELVITLCVPIILEGIINPRIKMDSEFWQLASSFRRRLSASRDNNQPQSATELQH
FT                   LAMFPKFVQNPESHLAEIAKTYMQLRLDAQRVKQHLDQCAETVLVSFSSSEVARHCRIQ
FT                   AAYAMLSTLAVLLNSLLRVFDPWNASLVSEAVFLCDEIATQAELASCYRPVGAGYIPLC
FT                   LVVAWAASDNLVQLARIEAILSEYQSDFAEVPWMSRAIWLASTLDSHRIRVMSGKQSPE
FT                   SSLEADSGDSHGAGTKKASVRPESCCIL"
     atgcctgggg ttccatctag tcggggctgc gatgcatgtc gcaaggtgaa gaagaagtgt        60
     gatcaactca aaccgacatg ctcacgatgc gcgcgtctga aaatgacgtg tgttggagga       120
     gggcaacaac ggtacatgtt caagaatcaa tcggtcaaag cgatgcaaac acaaagcgga       180
     gcagaaagtc aatcacagct tcagcagtcc tttccatcta ctggcaatag ggccgtgtgg       240
     attgggaaac cgacacgggt gcctagtact gacacgagta aaatggcagc agccttcgta       300
     gcagcattcc aggtgactga tatccgatat gctatggcct actatggacc tttcctgcgg       360
     gatattccac ggcgattggg caacagcacc gtgctagatt cagccgtgag agccttatca       420
     accgcttatt cattacttca cgcgggatct tacccaccga aagcactcgt tctctatgga       480
     caatcgctgc gggcactgag agaatgcttg aacgatccag ttgaggcccg aactcccaac       540
     acattatgcg ctgtctattt gattaccatc tgccagagct ggctaggaaa acatgacgat       600
     tcgctcacta gtcacagcga agctatcgct catctcctca gggctgccgc gctacacgag       660
     tggaagagca cattcgagat ggagctggtc attacactct gtgtgcctat aatactcgaa       720
     ggcatcatca atccccgtat caagatggat tcggaattct ggcaactggc ctcatctttc       780
     agacgtcgtc tatctgcttc acgggacaac aatcagccac aatcagccac cgagctgcaa       840
     catttagcca tgtttcccaa gtttgtccaa aaccccgagt cacaccttgc cgaaattgca       900
     aagacataca tgcaactgag actcgatgca caacgagtaa aacaacatct tgatcaatgt       960
     gcagaaactg ttcttgtatc tttctcatcg tctgaagttg cgagacattg ccgtattcaa      1020
     gcagcttatg ccatgctctc tactctggct gtgttattga acagccttct tcgagttttc      1080
     gatccctgga acgcttcgtt ggtgagtgaa gctgtctttc tctgtgatga gattgcaacc      1140
     caagccgaac tggcatcctg ctaccggccg gttggggcag ggtatattcc tctatgctta      1200
     gttgttgctt gggcagcatc agataatcta gtccagctgg caaggataga agcgatcctt      1260
     tctgaatacc agtctgattt tgcggaagtg ccatggatga gccgtgctat ctggttagcc      1320
     tctaccttgg atagccaccg gatacgagtc atgtctggga agcagtctcc agaatcctct      1380
     ttggaagctg attcaggaga cagtcatggt gctggtacca aaaaggcttc agtgcgcccg      1440
     gagtcttgct gtatcctcta g                                                1461
//

If you have problems or comments...

PBIL Back to PBIL home page