(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE176

PENCW_16.PE176       Location/Qualifiers
FT   CDS_pept        join(complement(402758..402821),complement(402519..402691),
FT                   complement(402077..402456),complement(401601..402027),
FT                   complement(400892..401551))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000239129" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947772"
FT                   /orf_name="Pc20g01760"
FT                   /product="Pc20g01760 protein"
FT                   /function="tetracycline:hydrogen antiporter activity "
FT                   /biological_process="response to antibiotic"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP85505.1"
FT                   /db_xref="GO:0015520"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0046677"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831489"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDR1"
FT                   /transl_table=1
FT                   /translation="MWFLPSCFKHPSHFSTDGPTKGCSSMRDFEDQAYTNRDDIPLKET
FT                   GESDDDEEKQVYPPSSKLAPILIGLCFQSFCIALDNTILSTAVPKITEEFNSLSDISWY
FT                   ASAYLLTTCAVTLPFGKIYTYYSTKWTYMIALGLFELGSLICAVTPTSKGLIFGRAIAG
FT                   VGSGGLSPGALLILANSVPLHRRALYFGIIGSTSGIATITGPLLGGLLTDHATWRWCFW
FT                   INLPFGVLTGLVILLFFKDSTSPKPKISRLGQLKRMDPLGILAFIPAIVSLLLCLQWGG
FT                   TKYSWNNARIIALFVLFGVFGFAWCLIQVWKQDDATVPPRLLKDRNVLGAVIHATFLGG
FT                   SFFVFGYYLPIWFQAVKEDSASESGINNLPMVVAMIVFSALGGLMVNIVGYYTPLMFVG
FT                   SAFLTIGSGLCTTFKVDSGRPQWIGYQVILGIGAGLGFQQCINALQTVLPLHDIPVGIA
FT                   IITFAQSLSGAMFISIAQTVFQNRLVASITTYAPNISPNALTKAGAANLSHLVPKNMLP
FT                   SVLHAYNIAVVQTFYVSVAAALLSFIGAGLVQWKSMKRRQKYDGASRSSQ"
     atgtggtttc taccttcctg tttcaaacat ccctcacact tcagcacgga tggtccgacc        60
     aaaggctgtt caagcatgag agatttcgag gatcaagcct atacaaatcg agatgacatc       120
     ccactgaaag aaactggaga gagtgatgat gatgaagaaa agcaagtcta tccaccgagc       180
     tcgaagcttg ctccgatttt gataggactt tgctttcaat ctttttgtat cgccttggac       240
     aacacaatcc tctcaaccgc cgttcccaaa atcaccgaag aatttaactc actaagcgac       300
     atatcgtggt atgcgagcgc ctatcttcta accacatgcg ctgtcaccct accatttggc       360
     aagatataca cgtattattc gacaaagtgg acgtatatga ttgctctcgg cttgtttgaa       420
     cttggatctc taatatgtgc agtgacgcca acatccaagg ggttgatttt cgggcgagca       480
     attgctggcg tcggatctgg aggattgtcg ccgggtgctc tactcatcct cgcgaatagt       540
     gtgccccttc accggcgtgc cctctatttt gggatcatcg gtagcactag tggaattgcg       600
     acaatcacag gaccattgct ggggggactc ttaactgatc atgccacttg gagatggtgc       660
     ttttggataa atctcccttt tggcgtcctc actggcctgg tgatcttact cttcttcaag       720
     gattccacat caccaaaacc caaaataagc cgtcttgggc agctaaagcg aatggatcct       780
     cttggtatcc ttgcattcat tccagcgatt gtctcccttc tattgtgcct gcaatggggc       840
     ggcaccaagt atagctggaa caatgctcga ataattgccc tatttgttct gtttggcgta       900
     ttcggatttg catggtgtct tatccaggtc tggaagcagg acgatgctac agtaccgcct       960
     cgtctactca aggatcgaaa tgtgcttggg gcagtgattc acgctacatt cctaggtggt      1020
     tcattttttg tctttggata ctatcttcct atctggtttc aagcagttaa ggaagattct      1080
     gcatcagaat ctggaatcaa caatcttccg atggtagtgg ctatgattgt cttctctgct      1140
     ttaggaggac ttatggttaa tattgtcgga tactatacgc cactcatgtt cgttggaagc      1200
     gcgtttctca caattggctc cggactgtgt acaactttca aagtggacag cggacgtccg      1260
     caatggattg gataccaagt cattcttgga attggagctg gacttggctt tcagcaatgc      1320
     atcaacgcac ttcagactgt actgccatta catgacatac cggtcggaat tgccatcatc      1380
     acatttgcac agagcctcag tggcgcaatg tttatttcaa ttgcccaaac cgtttttcag      1440
     aatcggcttg tggcaagcat aacgacctat gctcccaata tcagcccaaa cgcattaaca      1500
     aaagccgggg ccgcaaatct gtcgcacctg gtgccgaaaa atatgcttcc ctccgttcta      1560
     cacgcctata acattgccgt tgtccagaca ttctacgtgt ctgttgctgc cgcactactg      1620
     tcttttattg gtgctggact tgttcaatgg aagtctatga aaagacggca gaaatatgac      1680
     ggcgcatctc gatccagtca atag                                             1704
//

If you have problems or comments...

PBIL Back to PBIL home page