(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE177

PENCW_16.PE177       Location/Qualifiers
FT   CDS_pept        join(403481..403584,403671..403734,403964..404036,
FT                   404134..404312)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977588"
FT                   /orf_name="Pc20g01770"
FT                   /product="Putative uncharacterized protein Pc20g01770 "
FT                   /protein_id="CAP85506.1"
FT                   /db_xref="UniParc:UPI000183148A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDR2"
FT                   /transl_table=1
FT                   /translation="MATGPPHNYPCQSTLVYLGSRTGGLISSSRLERYWDREKGASEQH
FT                   PADLLGILIHHAFICDDKDRRRSNELYDGGSRSVCVSWLIVAEDCRLEGINLHRDLTVY
FT                   HEEPQAVGDLRLGARYFVGGYLAMIEQLGNEFWGS"
     atggcgactg gtccacctca caactaccct tgtcaatcca cacttgtata cttgggatcc        60
     agaactgggg gactgattag tagttctaga cttgaaagat actgggatag agagaagggg       120
     gcatctgagc aacatccagc agatctttta ggaatcctga tccaccacgc ctttatatgc       180
     gacgataagg atagaagacg cagtaacgag ctttatgatg gtggaagtcg aagtgtctgt       240
     gtatcatggt tgattgtcgc tgaggattgt agactagagg gcataaattt gcaccgagac       300
     ctaacggtgt accatgagga gccacaagct gtgggagact tgagacttgg cgctaggtat       360
     tttgtgggag gataccttgc gatgattgaa cagcttggca atgagttctg gggctcataa       420
//

If you have problems or comments...

PBIL Back to PBIL home page