(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE178

PENCW_16.PE178       Location/Qualifiers
FT   CDS_pept        join(405825..406236,406289..406330,406462..407124,
FT                   407155..407383,407440..407737)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000167080" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824361"
FT                   /orf_name="Pc20g01780"
FT                   /product="Pc20g01780 protein"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP85507.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000183148B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDR3"
FT                   /transl_table=1
FT                   /translation="MQTRRFLGLSGTKVQIAIGFLAGMDFLLFGYDQGVTGGLLTLDSF
FT                   VKYFPEINTLDSYTEHWSPSAKSNQSTRQGITVAAYNLGCFAGSIPTIWIGNILGRRKA
FT                   IFLGSFIMCVGAILQCTSYGLAQLVIGRLITGFGNGINTSTVPTWQSECCKSHRRGQMV
FT                   MIEGAMITCGITISYWINFGLMFADPNEVAWRFPLAFQIFFAAIILAFVMFLPESPRWL
FT                   ILKGREEEAKEVLACLMGDETDELFIDTEFTAIKATVLEMATGSFRDMFTMGEDRHFHR
FT                   TMLAYVNQMFQQISGINLITYYIPTLLEQQVGLDATISRLISACNGTEYFIASWIAVFT
FT                   VERFGRRTLMLFGAVGMSISMVVLAISDSISSTGVAQTVFLFVFNTFFAIGWLGMTWLY
FT                   PAEIVPLKIRAPANALSTSSNWIWNFMVVMITPVAFENIGYKTYIIFAVINAAIVPVVY
FT                   FFFPETTMRSLEEMDRIFRKTTSVFNVVSLANTEPHMYGPNGELLRTLDDVEDDAVRRA
FT                   SFLNKESKAQQQSHTQHAEKCSDEPTSEER"
     atgcagacca ggcggttctt gggccttagt ggcactaagg ttcagatcgc tatcggcttt        60
     ctggctggca tggacttcct gttgttcggt tatgatcaag gtgtgactgg cggtttgttg       120
     acactcgact ctttcgtcaa gtacttccca gaaatcaata ctctagattc atataccgag       180
     cactggagcc catcagcaaa gagtaaccag tcaacccgac aaggtatcac agtcgcagcg       240
     tacaacctgg gatgtttcgc aggctcgatc cccacgatct ggatcggtaa tatcttgggt       300
     cgtcgcaagg ctattttcct cggttctttt attatgtgtg tcggtgccat tcttcagtgc       360
     acatcatacg gacttgctca gctcgtcatc ggtcggttga tcactgggtt cgggaacgga       420
     atcaacacct ccacagtccc tacttggcag tcagaatgct gcaagtctca tcgacggggt       480
     cagatggtca tgattgaggg ggccatgatc acctgcggta taaccatcag ttactggatt       540
     aattttggac tgatgttcgc agaccccaac gaagtcgctt ggagattccc gctggccttc       600
     caaattttct tcgccgcgat tattctggcc ttcgtaatgt tccttccaga gtcaccccgt       660
     tggcttattc tgaagggtcg ggaggaagaa gcaaaggagg tcctggcatg cttaatgggt       720
     gacgagaccg acgagttgtt tattgacact gaattcaccg ccatcaaggc cactgttctc       780
     gaaatggcaa cgggatcatt ccgggatatg ttcactatgg gcgaggaccg tcatttccac       840
     cgcactatgt tggcatatgt caaccagatg ttccagcaaa tctcgggcat caacttgatc       900
     acctactata ttcccactct tctggaacaa caggtcggac tggatgccac aatctcgcgt       960
     cttatctctg catgtaacgg cacagaatat ttcatcgcct cctggatagc cgtgttcaca      1020
     gttgaaaggt ttggtcgtcg aacactcatg ctcttcggtg ctgtcggaat gtcgatctca      1080
     atggtggtgc ttgctatctc cgacagcatt tcttcaacag gtgtggcgca gacagtgttt      1140
     ttgtttgtgt ttaacacctt ttttgccatc ggttggcttg ggatgacttg gctgtatcca      1200
     gccgagattg tccccctgaa gattcgtgcg ccggccaacg cattgtccac ttcttccaat      1260
     tggatttgga acttcatggt tgtcatgatt acccccgttg cttttgaaaa cattggatac      1320
     aagacctata ttattttcgc tgtgatcaat gctgccatcg tgcctgtggt ctatttcttc      1380
     ttccccgaga ccaccatgcg ttcactggaa gagatggacc gtatattccg caaaactact      1440
     agcgtcttca atgtggtatc gctcgctaac actgagcccc acatgtatgg tcctaatggt      1500
     gaactcttgc gtactctgga tgatgtcgag gatgatgctg tccgtcgcgc cagcttcctg      1560
     aacaaggaga gtaaggctca acagcagagc cacactcaac acgcagaaaa gtgcagtgac      1620
     gaacccacta gcgaggagag atag                                             1644
//

If you have problems or comments...

PBIL Back to PBIL home page