(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE179

PENCW_16.PE179       Location/Qualifiers
FT   CDS_pept        join(complement(409960..409984),complement(409858..409909),
FT                   complement(409732..409807),complement(408965..409678),
FT                   complement(408598..408888),complement(408172..408549))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000202869" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824362"
FT                   /orf_name="Pc20g01790"
FT                   /product="Pc20g01790 protein"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP85508.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000183148C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE12"
FT                   /transl_table=1
FT                   /translation="MYTITNIYVLAAFGTIGGALFGFDVSSMSAWIGVDTYTDYFDSPD
FT                   SNLQGGITASMSAGSFAGSIAAGWLADILGRRYALMIASLVWIVGAVVQCSAQNVTHLV
FT                   AGRVVSGLAVGVTSSQTCVYLSELAPARIRGRIVGIQQWAIEWGILIMYLIAYGCVVGV
FT                   SGPAAFRICWGVQAVPGLILFIALFFFPESPRWLASQERWEEALDTLAIIHANGDRHDP
FT                   VVQVEFEEVQEAVRVAHESRDVSFMALFGPRVWKRTMCGMSVQMWQQLLGGNVAMYYVV
FT                   YIFEMAGMTGNTTLWSSAIQYVIFLVTTGCMLPFIDRVGRRNLLLIGSVTCMVVHYIIA
FT                   AVMASKGKPVPDVNGNANLTWEIKGSAGMTVIAFSYIFTGIYGLTWAPTAWIYAAEVFP
FT                   LKFRAKGVGLSAATNWIFNFALAYFVAPAFHNIQWKTYIIFGVFCTVMTFHVFFMYPET
FT                   VGRSLEEIDLVFETDVKPWRTHKIGDIFGEEIERRKELGAKTETGGATHEEVV"
     atgtatacta taacgaacat ttacgttctt gccgccttcg gtactattgg aggcgctctt        60
     ttcggcttcg atgtcagctc gatgagcgcc tggattggcg ttgatacata tacggattat       120
     ttcgactcac cagactccaa cctccaaggt ggaattacag catcgatgtc cgccggttcc       180
     ttcgctggtt caattgcagc cggttggtta gcagatattc ttggtcgtcg ctatgcctta       240
     atgattgctt ctctcgtttg gatcgtgggt gccgtggttc aatgcagcgc gcaaaacgtg       300
     acccacttgg tcgccggccg tgttgttagt ggacttgcag ttggtgtgac ctcctcgcaa       360
     acatgcgtct acttgtcaga actggcgccc gctcgcatcc gtggccgcat tgtgggtatt       420
     caacaatggg caatcgagtg gggtatcttg atcatgtact tgatcgcata tggctgcgtg       480
     gttggcgtat ctggaccggc tgccttccgg atttgctggg gtgtgcaggc cgtgccaggc       540
     ctcatcctgt tcatcgctct gttcttcttc cctgaatctc ctcgctggct cgcctcgcaa       600
     gagcgttggg aagaagcatt ggacacattg gcaatcattc acgccaatgg tgatcgccat       660
     gaccctgttg tacaggtgga attcgaagaa gtccaagagg ccgtacgtgt ggcgcatgaa       720
     tctcgggatg tctcattcat ggcattgttt ggacctcgcg tttggaagcg cacgatgtgt       780
     ggaatgagtg ttcaaatgtg gcagcaactt ctgggcggta atgttgccat gtattatgtg       840
     gtttacattt tcgaaatggc tggcatgact gggaacacaa cgctgtggtc ctctgcgatt       900
     caatatgtca ttttcttggt gactacaggc tgcatgcttc ccttcatcga tcgcgttggg       960
     cgaagaaacc tacttcttat cggatccgtc acctgcatgg ttgtgcacta tatcatcgcc      1020
     gctgttatgg ccagcaaggg gaaaccagtt ccagatgtca atggcaatgc caacttgacg      1080
     tgggagatca agggcagtgc aggaatgaca gtcatcgcct tttcatacat tttcaccggc      1140
     atctacggcc tgacttgggc tccgactgca tggatttacg ccgccgaggt tttcccgctc      1200
     aagttccgag caaagggcgt cggcttgtcg gccgccacca actggatttt caattttgct      1260
     ctggcttact tcgtggcacc agccttccac aacattcagt ggaagaccta cattatcttc      1320
     ggtgtattct gcacggtcat gactttccac gtgtttttca tgtatcctga gactgtgggc      1380
     cggtctctcg aagagatcga tctcgtcttc gagacggatg tgaagccatg gcgcactcac      1440
     aagatcggag acatattcgg agaagagatt gagcgccgca aggagcttgg tgcgaagacg      1500
     gagactggtg gtgcaacaca tgaagaggtg gtttga                                1536
//

If you have problems or comments...

PBIL Back to PBIL home page