(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE180

PENCW_16.PE180       Location/Qualifiers
FT   CDS_pept        join(complement(413918..414283),complement(413484..413857),
FT                   complement(412766..413432),complement(412030..412710))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181256" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947773"
FT                   /orf_name="Pc20g01800"
FT                   /product="Pc20g01800 protein"
FT                   /function="acyl-CoA dehydrogenase activity"
FT                   /function="acyl-CoA oxidase activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /biological_process="fatty acid beta-oxidation "
FT                   /cellular_component="peroxisome"
FT                   /protein_id="CAP85509.1"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="GO:0003997"
FT                   /db_xref="GO:0005777"
FT                   /db_xref="GO:0006635"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="InterPro:IPR002655"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR012258"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="UniParc:UPI000183148D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE13"
FT                   /transl_table=1
FT                   /translation="MPSPPPDWVKALKPSGPQGSELLHQERAQSNVDVERLSELLHTKE
FT                   TLERRASLLALLQPEKVFDKSQNHSLGRVERLQRSLAKAKRLQQLAEEHKWSMQELHAA
FT                   NDLIGEPTPYGLHASMFLVTLREQGTPEQHKLFLERAEKYEIIGCYAQTELGHGSNVRG
FT                   LETTATWNSNDKTFTINSPTLTASKWWIGSLGRTANHAVVMAQLFIDGKNYGPHPFVVQ
FT                   VRDLETHQPLDNVYVGDIGPKFGYNTMDNGFLLFNNVKIPHVNMLARFCQVDKETNQYA
FT                   KPAMPSLVFGTMTWVRANIVLDAGGVLARGVTIATRYCAVRRQFQDRDADPHAGETQVL
FT                   NYKMVQVRLLPLLASMYALHFTGRGMMRLYEENQSRMKAASSPDQESRGAGPEQLRAGA
FT                   NLLADLHATSCGLKALASTTAGEGLEICRRACGGHGYSSYSGIGPAYADYLPTLTWEGD
FT                   NYMLTQQVARYLLKSARAVLAGKPARNDTSQILQAYLDRRDKGASFDVLDEDKDIVAAF
FT                   GWRTAHLTFEALKHRDAEQRSWNSLLVDFWRLSTAHSQYLMVKNFYEAVSSPELSGALD
FT                   PETKGLMHQLFRLFSLHTLEREAAEFFSSGAVTVRQITLTRTTAVLKLLDDIRPHAVRL
FT                   VDAWAIPDWQLDSSLGRYDGKVYEDLFRRASEENPVNELVFDPYPWNSALLKNEPAKSK
FT                   L"
     atgccatcac ctcctcctga ttgggttaaa gccctgaagc cgtcaggtcc gcaaggatct        60
     gaactcctcc accaggagcg tgctcaatcg aatgtcgacg tcgaaagatt atccgaattg       120
     ctacacacaa aggaaacctt ggagcgacga gcatccctct tagctctttt gcagcccgaa       180
     aaagtattcg ataagtctca aaatcatagt ttgggccgtg tcgagcggct ccagcgatcg       240
     ctggccaagg ccaagcgcct ccagcagctt gcggaagaac acaaatggtc gatgcaagag       300
     cttcatgcgg ccaatgactt gatcggtgaa cctactccgt acggtttgca cgccagcatg       360
     ttccttgtga ctctccgaga acagggcact cccgagcagc ataaactgtt ccttgaacgt       420
     gcagaaaaat acgagattat cggttgctat gcgcaaacag aattgggcca cggatcgaac       480
     gtgcgcggtt tggaaaccac cgccacctgg aactccaacg ataagacatt caccatcaac       540
     tcgccaacat tgactgcctc gaagtggtgg attggatctc tcggtcgcac ggccaatcac       600
     gccgttgtta tggctcagct gtttatcgat ggcaagaact acggtcctca cccattcgtc       660
     gtgcaggtcc gtgatcttga gactcatcag ccattggata atgtatatgt gggcgatatt       720
     ggccccaagt ttggctacaa cacaatggat aatggtttcc tgctgttcaa caacgtcaag       780
     attccccatg tcaacatgct ggcccgcttc tgccaggtcg acaaagagac gaaccaatat       840
     gcgaagcctg ctatgccatc tcttgtattt ggtactatga cctgggtgcg ggccaacatt       900
     gtcctggacg ccggcggtgt tctggctcgc ggtgtgacta ttgcgacccg ttactgtgca       960
     gttcggaggc agttccagga ccgcgatgcc gatccacacg cgggtgagac ccaagtactg      1020
     aactataaga tggtccaggt gcgcttgctc ccacttttgg catctatgta cgcccttcac      1080
     ttcactggtc gcggcatgat gcgtctttat gaggagaacc aaagccgcat gaaggcagcc      1140
     agttcacccg accaggagtc gcggggcgct ggacccgagc agctccgcgc cggcgcgaac      1200
     ctcctggcgg atctgcatgc tacctcgtgt ggtctgaagg ctctggccag taccactgcg      1260
     ggtgagggtt tagagatctg ccgccgcgca tgcggtggtc atggatacag tagctacagc      1320
     ggcattggac cggcctatgc ggactatctg cccacattga cctgggaagg tgataactat      1380
     atgttgaccc agcaggttgc acgttatctt cttaaatctg cccgtgccgt cctggctggc      1440
     aagccggctc gtaacgacac tagccagatc cttcaggcat acctcgaccg acgagataag      1500
     ggcgcttcat tcgatgtgct cgatgaagac aaggacatcg tggctgcctt tggatggcgc      1560
     acggcccatc tcactttcga agctctgaaa catcgggatg ctgagcagcg ctcctggaac      1620
     agccttttgg ttgacttctg gcgcttgtcc acggctcact ctcaatacct gatggtgaag      1680
     aacttctacg aggcggtttc ctctcccgaa ctctcggggg ccttggatcc agagaccaag      1740
     ggcctcatgc atcaattatt ccgactcttc tcgctgcata ctctggagcg cgaagccgcc      1800
     gaattcttct cctccggtgc ggtgactgtg cgacaaatca ccctgactcg cactactgcc      1860
     gtattgaaac tacttgacga catccgcccg cacgctgtcc gattggtcga tgcctgggcg      1920
     attccagact ggcagctaga cagcagcctg ggtcgctatg acggcaaggt gtacgaagat      1980
     ttgttccgcc gcgcgagcga ggagaaccct gttaacgagt tggtgtttga cccttaccct      2040
     tggaattcgg cattgctcaa gaatgagccg gccaagagca agctgtaa                   2088
//

If you have problems or comments...

PBIL Back to PBIL home page