(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE181

PENCW_16.PE181       Location/Qualifiers
FT   CDS_pept        join(complement(416353..416565),complement(416266..416280),
FT                   complement(415812..416213),complement(415405..415761),
FT                   complement(415010..415357))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171144" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947774"
FT                   /orf_name="Pc20g01810"
FT                   /product="Pc20g01810 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP85510.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000183148E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE14"
FT                   /transl_table=1
FT                   /translation="MATTCEIQSSRDTSFIALETLPHGQSDTDSRLGPESFPLLEKWNQ
FT                   PRINIHRTFATFWSFLVMGANDAAYGALIPYLESYYHLSYTIVSLVFLSPLVGYTVAAF
FT                   LNHRIHYTLGQRGVAIIGPACHLIAYVINCIHPPYPVLVVAFIFAGLGNGLEDAAWNAW
FT                   LGNMANANELLGVLHGIYGAGAVISPLVATSMIAKGGLPWYYFYYVMTGCAAIELVVSG
FT                   ACFWKSTAADFRASNVSSADNKKGGLRNALFKRPAARVTWLCALFLLGYVGVEVALGGW
FT                   IVTFMIRVRQGGAFASGMTATGFWLGITVGRVILGFVTPRVGEKVAISVYIVCSMAFAL
FT                   VLWLVPQFYVSAVAVSLQGFFLGPLFPGVVVMVTKLLPRHLHVTSIGFVAAFGGSGAAI
FT                   LPFAVGVLAQAKGVQVLQPFIVALSGAILLTWLGLPRVSKVRHNE"
     atggcaacta cctgtgagat tcaaagttcg cgcgatacga gttttatcgc tctggagact        60
     ttgcctcatg gccagtcaga tacagattca cgtttgggcc ctgaaagctt tcccttgttg       120
     gagaaatgga atcagcctcg catcaatatt catcggacct ttgcgacctt ctggtcattc       180
     ctggtcatgg gtgcgaatga cgcagcctat ggtgctctaa ttccatatct ggaatcatac       240
     taccatctat cgtacaccat tgtgtctctc gttttcttgt cacctctcgt aggctataca       300
     gtcgcagctt ttctcaatca ccggatccac tatactctag gtcaacgtgg tgtggcaata       360
     atcgggccag cgtgccatct cattgcctat gttatcaact gtattcatcc accgtatccg       420
     gtactagtgg tcgcattcat ctttgcaggg ttaggaaatg gcctagagga tgctgcatgg       480
     aatgcatggc ttggtaacat ggccaacgca aatgagttgt tgggagtgtt gcatgggatc       540
     tacggagccg gtgcagtcat tagtccgttg gtcgcaacgt caatgattgc caagggtggt       600
     ctgccgtggt attactttta ttatgtcatg accggatgtg cggccatcga attggtggtc       660
     tctggcgcat gcttctggaa atcaaccgcc gctgatttcc gcgcatccaa cgtatcatca       720
     gcggataaca aaaaaggcgg tttgagaaat gcactgttca agcgcccagc tgcccgggta       780
     acctggctct gcgcattgtt cttgctgggg tacgttggag tagaggtcgc gttgggagga       840
     tggatcgtta cttttatgat ccgagtccga caaggcggtg cttttgccag cggtatgacg       900
     gccactgggt tctggttagg tatcacggtt ggacgggtaa ttttggggtt tgtcacgccc       960
     cgggtcggcg agaaagtcgc aatttcggtc tacatagttt gctccatggc gtttgctttg      1020
     gttctatggc ttgtgcccca gttctatgtg tcggccgtgg cagtgtcttt gcaaggcttc      1080
     tttctcggcc cccttttccc cggggtagtt gtgatggtta ccaagcttct tcctcggcat      1140
     ctgcatgtca cctcgatagg gtttgtcgct gcctttggag gtagcggagc cgcaattctc      1200
     ccatttgcgg tcggtgtact tgcgcaagcc aagggggtgc aagtactgca gccatttatc      1260
     gttgccctat ccggtgcgat tctccttaca tggctgggat tgccgcgggt gtccaaggtc      1320
     agacacaatg aatag                                                       1335
//

If you have problems or comments...

PBIL Back to PBIL home page