(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE182

PENCW_16.PE182       Location/Qualifiers
FT   CDS_pept        join(417257..417658,417723..418179,418228..418401,
FT                   418451..418983)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000112982" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977589"
FT                   /orf_name="Pc20g01820"
FT                   /product="Pc20g01820 protein"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAP85511.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniParc:UPI000183148F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE15"
FT                   /transl_table=1
FT                   /translation="MSYVNPIIPGFNPDPSIVRVDRDFFLVTSSFEYFPGVPIYHSQDL
FT                   IQWKLIGHALTRPSQLQIHTPEPGGGVWATTIRYHGGAYYVIAASFQRYRPQQDDRVWP
FT                   QGFYVKTTDIWNEKTWSDPVYFDQVGFDQDLFWDDDGTVYLSSTYRKIQPTTGAKLKDF
FT                   AIHICTVDLATGHSTSVPKLIRESSSGVAEGSHIFKRGRYWYLFTAEGGTESGHCEWVN
FT                   RSEVSPLGPWELGPNNPLWRNGVDDEVQNTGHADLVEDTKGQWWAVVLGVRPSRRGDTW
FT                   EDSVLGRETFLVPLEWKDDWPVINGGQKISLNSHGPGLYEFHTPVSWRDEFLDSQMQVG
FT                   WYRKNTPFVTDYSLTERPNYLRLHGGPYNLSVPASPTMFLRKQTHHFCRWETRLSFEPT
FT                   AAETEAGTVVWLNYFTYSSIGIRKDGKGRFIRFRPSKGDTVERRLDTKTAVTLTVDCGT
FT                   EYRFGYREDTHSDVHWIGSVSNNAATAAPPVGANFTGMMLGLYAFGERQRCLAPADFAY
FT                   AEFR"
     atgagttacg ttaatcccat tatcccggga tttaatcccg acccatcgat tgttcgtgtc        60
     gatagagact ttttcttggt cacatcctcc tttgaatact tccctggcgt tcccatctac       120
     catagccagg atttgattca gtggaaattg ataggccatg cattgacacg gcccagtcag       180
     cttcaaattc acaccccaga acccggagga ggagtgtggg caaccacaat tcgatatcac       240
     ggaggtgctt actatgtcat cgctgcgagc tttcagcgtt accgtcctca acaggatgac       300
     cgagtttggc cacagggatt ttatgtcaaa acaaccgata tctggaatga gaagacatgg       360
     tctgatccag tctattttga tcaagtggga tttgaccaag atcttttttg ggatgacgat       420
     ggaaccgtat atttatcgtc cacctataga aagattcagc caactactgg tgccaagctg       480
     aaagactttg cgattcatat atgtactgtt gacttggcaa ccgggcattc tacgtccgta       540
     cctaaattga tccgggaatc ttcttctggt gttgccgagg ggtcgcatat tttcaaacgc       600
     ggccgttatt ggtatttgtt cacagcggaa ggtggcactg aaagtggaca ttgcgaatgg       660
     gtgaaccgta gtgaagttag tccattggga ccgtgggaac tcgggccaaa taaccctctc       720
     tggcgcaatg gcgttgacga cgaagtacaa aacaccgggc atgccgatct ggttgaggac       780
     accaaagggc aatggtgggc ggtagttcta ggtgttcgtc cttcaagacg gggagatacg       840
     tgggaggact cagtgctagg ccgagagacc tttctagtcc ccttagaatg gaaagatgat       900
     tggcctgtga tcaacggagg acagaaaatc agtctcaatt cccatggacc tggtctttac       960
     gaattccata ctccagtctc ctggagagat gaatttttgg actcgcaaat gcaggttgga      1020
     tggtatcgaa aaaacacgcc ctttgtaact gactactcac ttaccgagcg ccccaattac      1080
     cttcgtctcc atggcggacc ttataacctg tcagtgccag ccagtccaac catgttcctt      1140
     cgcaagcaaa cccaccactt ctgcaggtgg gagacaaggc tctcctttga gccgacggca      1200
     gccgaaacag aggctggcac tgtggtatgg ttaaattatt ttacgtatag cagcatcggt      1260
     atccggaaag atggcaaggg ccgtttcatc cgttttcgac cgtcaaaggg cgacaccgtg      1320
     gagcgtagat tggatacaaa aactgctgtc actctcacag ttgactgtgg caccgagtat      1380
     cgatttggat atcgagaaga cacacattcc gatgtccact ggattgggtc agtttctaac      1440
     aatgctgcta cggcagcacc tccggttggg gccaacttta ctggcatgat gctgggtcta      1500
     tatgcgtttg gagagcgcca gcgatgtctg gctccagctg attttgcgta cgcagagttt      1560
     agataa                                                                 1566
//

If you have problems or comments...

PBIL Back to PBIL home page