(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE186

PENCW_16.PE186       Location/Qualifiers
FT   CDS_pept        join(426313..426540,426597..426751,426801..427127,
FT                   427188..427596)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000169461" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947776"
FT                   /orf_name="Pc20g01860"
FT                   /product="Pc20g01860 protein"
FT                   /biological_process="isoprenoid biosynthetic process "
FT                   /protein_id="CAP85515.1"
FT                   /db_xref="GO:0008299"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR017446"
FT                   /db_xref="UniParc:UPI0001831493"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE19"
FT                   /transl_table=1
FT                   /translation="MLGLTAAKVFAFISQYIPRITIFTNNKPAASTYYHRRKDLKGFQI
FT                   LQAHTNHTQQNLTLSDGTDSGDCQITEPYEKIVSAPLEYLLCIPGKDIRGKLISAFNEW
FT                   LHLPDDKLAIVKEVIDRLHTASLLIDDIQDASRLRRGHPVAHDVFGVAQTINAANYAYF
FT                   LQQKRLNEINDPRAFHIFTQALLDLHIGQGMDLYWRDALVCPTEAEYTRMVMYKTGGLF
FT                   RLAVELMQIQSTTTTDLSRLVGLLGIIFQIRDDYMNLQSGIYAEKKGLMEDLTEGKFSY
FT                   PVIHSIRADPDNTQLINILKQRSEDRAVKVRAVQYMESTGSFQYCREVLSGLMEQARGH
FT                   VDELETLLGPNQEIHRILDLLQVDPPNVNPRP"
     atgctcggcc taacagcagc aaaagtattc gcttttattt ctcagtacat tccccggata        60
     acgattttta ccaataataa accggcggct tccacatatt accataggag gaaggatctc       120
     aaagggttcc aaatacttca agctcacaca aatcataccc aacaaaacct cacattaagt       180
     gatgggaccg acagtggaga ttgccagatc actgaaccgt acgagaagat tgtcagcgct       240
     ccgctagaat acctgctatg tattccaggg aaagatattc gggggaaatt gatatcagct       300
     ttcaacgaat ggctccatct gccggatgat aaattggcca ttgtgaaaga agtgattgat       360
     cggctacata cagcatcgct actgatagat gatattcagg atgcgtcccg tctccgccgg       420
     ggacatcctg tggctcatga tgtcttcggc gtcgcccaaa ccatcaatgc agccaactac       480
     gcatatttcc tacaacagaa aaggcttaac gaaatcaatg acccacgcgc atttcatatt       540
     ttcactcaag cgttgctgga tctgcatata ggccaaggga tggatctcta ttggcgcgat       600
     gcgctggtgt gtcccacaga agcggaatac acccgcatgg taatgtacaa aaccggcgga       660
     ttgtttcgac ttgcagtgga attgatgcaa atccaaagta ccacgactac ggacctttcc       720
     cgactagtgg ggctattggg tatcatcttc cagatccggg atgattatat gaacctacag       780
     agcgggatct acgcagagaa aaaaggattg atggaggact tgacagaggg aaagttctcc       840
     tatcctgtaa ttcatagcat ccgtgcggat ccagacaata cgcaactcat caatattctc       900
     aaacaacgca gtgaagacag agcagtcaaa gtccgtgctg tgcagtatat ggagtcaacg       960
     gggagttttc agtactgccg ggaagtattg agcgggttga tggagcaggc acgaggccat      1020
     gttgatgagc tggagacgct cttgggtccc aaccaggaaa ttcatcgtat tcttgattta      1080
     cttcaggttg acccaccaaa tgtgaatccg aggccatga                             1119
//

If you have problems or comments...

PBIL Back to PBIL home page