(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE187

PENCW_16.PE187       Location/Qualifiers
FT   CDS_pept        complement(428385..428834)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000267215" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128699"
FT                   /orf_name="Pc20g01870"
FT                   /product="Pc20g01870 protein"
FT                   /protein_id="CAP85516.1"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="UniParc:UPI0001831494"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE20"
FT                   /transl_table=1
FT                   /translation="MGSGPAKTCFATSSPYEEKIGYYRAVRHGNQIFVSGTTSVDPYSP
FT                   TNAPHVLHPEDARQQTRVALEESIRAIQGLGGKGAEDIVRVKMFVSRHEDCEAVGRGFS
FT                   EILGKHNRGGSGMIGAAATMIVVNGGFINKEMLVEIEVDAVVEYI"
     atgggttccg ggccagcgaa aacctgcttc gccacctcat caccatacga agaaaagatt        60
     ggttactacc gggccgttcg gcatggaaat cagatcttcg tctccgggac tacctcggtt       120
     gatccctatt ctcccactaa tgcgccgcac gttcttcacc cggaagatgc gagacagcag       180
     acccgtgttg ctctagagga gagtattcga gctatccaag gtcttggtgg taaaggtgcg       240
     gaagatatag tccgcgttaa gatgttcgtc agccgccatg aggactgtga ggctgtgggg       300
     cgagggttta gtgagatatt gggtaaacat aatcgtggtg gaagtggaat gataggagct       360
     gctgcgacaa tgattgttgt caatggcggc tttataaata aggagatgct tgttgagatc       420
     gaagtagatg ctgttgtgga atatatctag                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page