(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE188

PENCW_16.PE188       Location/Qualifiers
FT   CDS_pept        complement(429477..431018)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234798" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947777"
FT                   /orf_name="Pc20g01880"
FT                   /product="Pc20g01880 protein"
FT                   /protein_id="CAP85517.1"
FT                   /db_xref="InterPro:IPR009197"
FT                   /db_xref="InterPro:IPR010799"
FT                   /db_xref="InterPro:IPR015995"
FT                   /db_xref="UniParc:UPI0001831495"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE21"
FT                   /transl_table=1
FT                   /translation="MSQRPVIAIAGLACETSTFSPARTLGRAFHPRRGPEIIEKYAFLH
FT                   NSTPLADVADWKGALIGHALPGGIVVRADFEQLSREILERLAAIVASNPIDGLWYDIHG
FT                   AMCVDGMEDVEAELLRRIRSVIGPNVLVSASMDLHGNVSRELAHQTDLITCYRMAPHED
FT                   ALETKERACRNLIDVLTSRTDTGCRRPLKAWVPIPILLPGEQTSTRDEPAKSLYSLVPE
FT                   IEAMENVLDAAIWVGYAWADEPRNHAVVMVTGWDKSAVTTGAKRLASLFWRVHKDFHFA
FT                   APTGSFSECIDNALASSNRPFFISDSGDNPTAGGSGDVTFGLNELLKRAEFAKETTRSV
FT                   IYASIPGPQAIDVITKAGVGTTVTVTAGAQVDNLHAGPVTMTGRIHSIRYGDPDAEIEA
FT                   VLQVGSVFTILTKFRKPYHHESDFVGLDLSPRVTNIVIVKIGYLEPELFNMAADWMIAL
FT                   TPGSVDQYLQRLGHHRILRPMWPFDKTFYRAPDLTPRLIPFSNEDLGAPQGLSLE"
     atgtctcaac gaccagttat cgcaatcgct ggacttgctt gtgagacctc gaccttttcc        60
     cccgctcgaa cactcggtcg ggcatttcac ccgcgccgtg gcccggagat catcgagaag       120
     tacgcttttc tgcataacag cactcctcta gcagatgtgg cagattggaa gggggcactt       180
     ataggtcatg cccttccagg gggaatcgtg gtacgagctg atttcgaaca actttccaga       240
     gaaatcctgg agcggttggc tgcaatcgtc gcttcaaacc ccatcgacgg attatggtac       300
     gatatccatg gcgcaatgtg cgtcgatggg atggaagatg tggaagcaga gcttcttcgg       360
     cggattcgaa gtgttatcgg cccaaatgtt ttggtctcgg cgtccatgga tttgcatggg       420
     aatgtgtcaa gagagctggc gcatcagact gatctgatca cttgttatcg tatggcacct       480
     cacgaggacg ccttggaaac caaagagcgg gcgtgtcgca acctgatcga cgttttgaca       540
     tcgcgaaccg acactgggtg taggagaccg ctgaaagcat gggtcccaat tcctatcttg       600
     ctgccgggag agcagacttc gactcgcgac gaaccagcga aaagcctgta ttcgctcgtt       660
     cccgaaattg aagcaatgga aaatgtcctt gatgcagcca tatgggttgg ctatgcatgg       720
     gccgatgagc caaggaatca tgccgtagta atggtcactg gatgggacaa aagtgctgtg       780
     actacaggag cgaagcgact tgcgtctttg ttctggcgtg ttcataagga cttccatttt       840
     gctgccccca ccggctcttt ctctgaatgc attgataatg cgctggcatc ctcgaatagg       900
     cccttcttca tctctgattc gggcgataat cctaccgctg gcggatcagg cgacgtgacc       960
     ttcggattaa atgaattgct caagcgagcg gagtttgcga aagagaccac tcgatctgtg      1020
     atttatgcga gtattccagg tcctcaggca attgatgtta taaccaaggc tggtgtgggc      1080
     actactgtga cagtcaccgc cggggcacag gtggacaatc tccacgctgg gcccgttact      1140
     atgacgggac gaattcattc cattagatat ggagatcccg atgccgaaat tgaagctgtt      1200
     ttacaggttg gaagtgtgtt taccatctta accaaattcc gaaagccata tcaccatgag      1260
     agtgatttcg ttggtcttga ccttagcccc cgagttacaa acatcgtcat agtcaagatt      1320
     ggctatctcg agccagagct gtttaatatg gcagcggact ggatgattgc tttgactcct      1380
     ggtagtgttg atcaatatct acagcgtctt gggcatcatc gcatcctccg tccaatgtgg      1440
     ccctttgaca aaacgttcta tagggccccg gacctcaccc cacggctgat tccattctca      1500
     aacgaggact tgggagcgcc ccagggatta agccttgaat ag                         1542
//

If you have problems or comments...

PBIL Back to PBIL home page