(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE189

PENCW_16.PE189       Location/Qualifiers
FT   CDS_pept        join(431397..431497,431619..432312)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000100908" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947778"
FT                   /orf_name="Pc20g01890"
FT                   /product="Pc20g01890 protein"
FT                   /function="copper ion binding"
FT                   /biological_process="copper ion homeostasis"
FT                   /protein_id="CAP85518.1"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0055070"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="UniParc:UPI0001831496"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE22"
FT                   /transl_table=1
FT                   /translation="MSQTAITQIPILEIACFNQESAVVAARAGADRIELCKDYHLGGLS
FT                   ADIEILQELKSQLTTPIYTMVRPHAEGFCYGESDFESMKRTLNSLKSCGADGFVFGILN
FT                   RSPQMSCDPNLPWVDVSRNKQLVQLAGGRPCTFHRAFDLIPESHWENALADIMECGFAS
FT                   ILTNGGPSGTKATESMDKLQTLVRYKTQLQREQKIRGNRVPEIIVGGGVRASNIGLLQS
FT                   ITGASAFHSAALVASKAVTSAKEVSDMKGGIAQAWEADKKAQ"
     atgagtcaaa ctgctattac ccagatacca atcctagaga ttgcatgttt caatcaagaa        60
     tcggcagtgg ttgctgcgag ggcaggagcg gaccgcatcg agttatgcaa agactaccat       120
     ctcggtgggc tatcggccga catagagatt ctccaagaat tgaaatcaca gctcacaaca       180
     ccgatttata caatggttcg gccacacgcg gaaggcttct gttacggaga atctgacttt       240
     gaatcgatga aacgaacgct caattctctc aagtcctgtg gggctgacgg tttcgtcttc       300
     gggattctga atcgatcccc acaaatgtcc tgtgatccaa atttgccatg ggtcgatgta       360
     tcccggaata agcagctcgt tcaactagct ggcgggcggc cctgcacatt ccatcgcgct       420
     tttgatctca ttcccgaatc tcactgggag aacgcattgg ccgatatcat ggagtgcggg       480
     tttgcatcaa ttttaaccaa tggtggccct tctggaacaa aagcaaccga atccatggac       540
     aagctgcaaa ccttagtacg ttacaaaacg caactccaac gggaacaaaa aattcgaggc       600
     aacagagttc cggagattat tgttggaggt ggtgtgagag catcaaacat aggcttgctc       660
     cagagcatca ccggtgcctc agccttccat tctgctgctc tcgtggcctc gaaagcggta       720
     acctccgcaa aggaggtatc tgacatgaaa ggtgggatag cgcaggcatg ggaggcagat       780
     aaaaaggcgc aataa                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page