(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE190

PENCW_16.PE190       Location/Qualifiers
FT   CDS_pept        join(433686..433794,433902..433972,434066..434302,
FT                   434357..434369,434425..435149,435198..435641)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000202588" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128700"
FT                   /orf_name="Pc20g01900"
FT                   /product="Pc20g01900 protein"
FT                   /function="nucleobase transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP85519.1"
FT                   /db_xref="GO:0015205"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR012681"
FT                   /db_xref="UniParc:UPI0001831576"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE23"
FT                   /transl_table=1
FT                   /translation="MTLGGKLKFWLKKIQVPSEPGLSTAQLMLTNDDLRPVEPERRQWG
FT                   WLNFVAFWIADSLNVNTWMISSSMIVDGLSWWQSWLCVWIGYTVAAIFVYVLGRIATIY
FT                   RIPFAVANRASFGIWGSFWPIINRAAMAVIWYGVQSYLGGECVTLMIAAIWPSYNNLPN
FT                   TIPSSSGVTTKQFVSFFIFWLLSLPALWFPIYKVRHVFTAKAYFSPACAIAFFGWAIAR
FT                   AHGLGPIIDQPNKAQGSALAWAFVKSIMNCIANFAALVINNPDFTRYARDPKDALWPQL
FT                   ITIPVGFAVTSFIGIIVSSSSSVIFGEAVWNPLTLLGMFLKDASSAERFGIFVIGAGFA
FT                   LAQLGTNIAANSVSAGTNLTALLPRFCTIRRGGYLCAAIGLAMCPWTLVASSSKFTLYL
FT                   SAYSVFLSAIAGVMVSDYYLVRKGFLDIQALYSAERDGIYYGTFGVSWHGYAAYISGIL
FT                   VNIVGFAGAIGVNVPIGAMYIYNVNYFSGFIVSGAVYWALAWLVPIPGTSDTWNEIPYE
FT                   PHHMSDSDEKKVGDV"
     atgactctag gcggcaagtt gaagttctgg ctcaaaaaga tccaagtgcc ctcggagcct        60
     ggattgtcaa ccgcgcagct gatgttgaca aacgatgatc ttcgaccagt tgaaccagag       120
     cgccgtcaat gggggtggct caattttgtt gccttctgga ttgcggattc cttaaatgtg       180
     aatacatgga tgatttcatc ctcaatgata gttgatggac tttcttggtg gcagtcttgg       240
     ctatgcgttt ggattggtta tactgtggca gccatttttg tttacgtatt aggtcgcatt       300
     gctaccatct atcgcatccc tttcgcggtg gccaatcgag cttcattcgg gatttggggt       360
     tcgttctggc ccatcatcaa ccgagcagcg atggctgtga tctggtatgg tgtacagagc       420
     tatctaggag gtgaatgcgt gactttgatg attgctgcta tctggccaag ctacaacaat       480
     ctgccaaata caatccccag ctcatcaggg gtaaccacta agcagtttgt tagcttcttt       540
     attttctggc tgctgtcttt gccggctctt tggttcccca tttacaaggt ccggcacgtt       600
     tttacggcaa aggcatactt ttcgccggct tgtgctattg cattttttgg ctgggcaatt       660
     gctcgcgctc acggactggg gccaataatc gaccagccta acaaggcgca gggcagtgct       720
     ttagcctggg catttgtgaa aagcattatg aactgcatcg caaactttgc agcattggtt       780
     atcaacaacc ccgatttcac cagatatgct cgcgacccca aggacgcact atggccccag       840
     ctgatcacaa ttcctgttgg ctttgcggtg acatcgttca tcgggattat tgtttcctcg       900
     tcatctagtg ttatcttcgg cgaagcggtt tggaaccccc ttacccttct tggtatgttt       960
     ttgaaggatg caagctccgc cgagcgattt gggatcttcg ttattggagc tggctttgct      1020
     ctcgcacagc tagggacgaa tattgcagcc aactccgtgt cagctggtac caatctcaca      1080
     gctctgctcc ctcggttttg cacgattcga cgcggaggat atctgtgtgc ggcaatcggt      1140
     cttgctatgt gtccctggac cttggttgca tcttccagca aattcacctt gtacctctct      1200
     gcttattcgg tatttctttc cgctatcgca ggagtcatgg ttagtgacta ctacctagtc      1260
     cgtaagggct tccttgacat ccaagcgctg tatagcgctg aacgggatgg gatttattac      1320
     ggaacgtttg gggtttcctg gcacggttat gctgcctaca tatccggcat cttggtcaac      1380
     attgttggtt ttgctggtgc tattggtgtt aatgttccta ttggcgccat gtacatctac      1440
     aatgtcaact acttttcggg gttcattgtc tccggagcag tctattgggc gctagcctgg      1500
     ttggttccta ttcccggaac aagtgataca tggaacgaga taccctacga accacatcat      1560
     atgtctgatt cagacgagaa gaaggtgggg gatgtttaa                             1599
//

If you have problems or comments...

PBIL Back to PBIL home page