(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE191

PENCW_16.PE191       Location/Qualifiers
FT   CDS_pept        complement(436899..437900)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947779"
FT                   /orf_name="Pc20g01910"
FT                   /product="Putative uncharacterized protein Pc20g01910 "
FT                   /protein_id="CAP85520.1"
FT                   /db_xref="UniParc:UPI0001831577"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE24"
FT                   /transl_table=1
FT                   /translation="MAESRGGPSNPKFSDLVPLLKGESNWEIWKQYMEIALNGIDPSYW
FT                   PLLIGQDKRPTNLPGMEDSEVDFEDAVTEIDDDTPAHPTAAFATQPTQPTTTKAAIAKR
FT                   KKAQQAWDQKNAIVLSYVASSLDATMLLYFRGGHTAALVYEELRSLYEGKIFFSIRNKV
FT                   TKWATWKYKAGTKPEEFVTEWRHLFTEMQVALPIEQRVSSLYAIYVFLHAVSNNTACQH
FT                   WLNTVSIHDDWSYDEILHNIFGVFIASEGRRIRNDGQLQKQQASANIASADNNKKKKKK
FT                   DNPKGEKEEDKQTKKQYCPFHKRETIHKPKDCFLNPKKKDKSESASMENLWC"
     atggcggaat cacgtggagg accttcgaat cccaagttct cggacctcgt acctttgctt        60
     aagggcgagt cgaactggga gatatggaaa caatatatgg aaatcgccct caatggcatt       120
     gatccctcat actggcctct tcttattgga caggacaaac gtcctactaa tcttcctggc       180
     atggaagact cggaagtcga ctttgaagac gcagttacag agatcgacga tgacacacct       240
     gctcatccca ctgctgcttt tgctactcag cctacacagc ctaccactac aaaggcggct       300
     atagcaaagc ggaagaaggc tcagcaagca tgggaccaga agaatgcaat tgtcttgtca       360
     tacgttgctt cttctctgga tgccaccatg ttactctact tccgcggcgg tcataccgct       420
     gctctagtgt atgaagaact ccggtctctc tatgagggaa agatattctt ctccattaga       480
     aacaaggtca ctaagtgggc tacatggaag tacaaagctg gaaccaaacc agaagaattt       540
     gtcacagagt ggcgtcatct tttcaccgag atgcaagtag ctcttccgat agagcagcgc       600
     gtctcatctc tctatgcaat ttacgtgttt ctacacgcag taagcaacaa cactgcatgc       660
     caacactggc taaacactgt ctcaattcac gacgactggt cttacgacga aatccttcac       720
     aacattttcg gagtttttat tgcttctgag ggacgacgaa ttagaaacga tggtcagctc       780
     caaaaacaac aagcttctgc caatatcgct tccgccgaca acaacaagaa gaagaaaaag       840
     aaagacaacc ccaagggtga aaaggaggag gacaagcaaa ccaaaaagca atattgtccg       900
     tttcacaagc gagagacaat acacaaaccc aaagactgct tcctaaatcc aaagaaaaag       960
     gataaatcgg agtctgcttc catggaaaac ctctggtgct aa                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page