(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE192

PENCW_16.PE192       Location/Qualifiers
FT   CDS_pept        join(complement(441158..441277),complement(440924..441106),
FT                   complement(440511..440870),complement(439917..440457),
FT                   complement(439542..439861),complement(439304..439481),
FT                   complement(438866..439215))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000159172" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947780"
FT                   /orf_name="Pc20g01920"
FT                   /product="Pc20g01920 protein"
FT                   /biological_process="metabolic process"
FT                   /protein_id="CAP85521.1"
FT                   /db_xref="GO:0008152"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015936"
FT                   /db_xref="InterPro:IPR015937"
FT                   /db_xref="UniParc:UPI0001831578"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE25"
FT                   /transl_table=1
FT                   /translation="MTISEKIFAMHDLNHKGFVAPGDIIRVHVDWILASEVSWAGMETT
FT                   YNHLGKPGIFRNDRFWLCGDHVVDPRVNELPQVQALISGSERAKKTFKMTEYQGMNYTI
FT                   LHTEFYRERAQPGMLVVGSDSHTCSSGAVGCLAIGLGAADVALPLVTGETWFQVPETIN
FT                   IRLVGAPKPGIGGKDVILYILQVLKRNTIASDRIVEFTGPALRHLSPDTRFAVSNMTTE
FT                   LGGITGIFMPDDTTHNFINRRKLARHKCHTTYFRPDADAEYAAVHQIDLTHVGSFIARY
FT                   PNPDDVVPVTEEEGMELNGCFIGACTTTEEDLILGALVMEQAMKRGSKPTAKGKRKVVP
FT                   GSMPILYRLRKLRLCDIYEDAGFEIGIPGCSYCVGMSADQAAPGEVWISSQNRNFENRM
FT                   GKGSIGHLASAATVAASSFEMKLVDPSDLLAAIDLSRWRQLTTASTHSDATSPKSDLIY
FT                   VEPCGCDYHRAGAQTQKQIEKPRLDIHGRGQTKSLQGKVQRLGDFVNTDALAPAEFLIG
FT                   MKNNMDAGLRCLVHTHPKFRERAQQGFNIVVGGKGFGCGSSREQAVMALLGCGVQCVIA
FT                   KSFSFIFQRNMPSLGLLGITMEDESFFQVADDGVSISIDLNSRIIDVAGKTFGFKLSQM
FT                   ETEIFQFGGIASAFGVFGNKLLEAITPAKSPSGYKQEESEQPDKLLQW"
     atgactataa gtgaaaagat atttgcgatg catgacctaa accacaaagg gtttgtggct        60
     ccaggcgaca taattcgtgt ccatgttgac tggatacttg cctctgaggt gtcttgggcc       120
     ggaatggaaa caacatacaa tcatctaggg aagcctggaa tatttcgaaa cgaccgcttc       180
     tggctttgtg gggaccatgt tgttgatcct cgggttaacg agctacctca agtgcaggcg       240
     ctgatcagcg gaagcgagag agcgaagaaa actttcaaaa tgacagaata ccaaggcatg       300
     aattacacta ttctccacac tgagttctac cgagagcgcg cccaacccgg aatgctggtc       360
     gtcggctcgg actcacacac gtgttcgtca ggagcagtag gctgtctcgc aattggactg       420
     ggtgctgcag atgtcgcctt accgttggta actggagaaa catggtttca agtcccagaa       480
     accatcaaca tacgcctggt tggagcaccg aagccaggga ttgggggtaa agatgtcatt       540
     ttgtacatct tgcaagttct caaaagaaat actatagcat ccgacaggat cgtggaattt       600
     acaggcccgg cactcaggca tttatcccct gatacccgat tcgcagtttc caacatgacc       660
     acggaacttg gtggcattac tggcatattt atgcctgacg acaccaccca caactttatt       720
     aatagacgaa aactcgctcg tcacaaatgc cacacaacgt acttcaggcc cgatgccgat       780
     gcagagtatg ccgcagttca tcagatcgat ctcacgcatg tggggtcttt tatcgcacgg       840
     tatcccaacc cggatgacgt ggttccagtt acggaagaag agggaatgga gttgaatggg       900
     tgttttatcg gggcatgcac tactaccgag gaagatctga tccttggtgc tctagtaatg       960
     gagcaagcaa tgaaaagagg atcaaagcct accgcaaaag ggaagaggaa ggtcgttccc      1020
     ggttccatgc caatactgta tcgcttacgc aaactgaggt tatgcgatat atacgaagac      1080
     gcaggatttg agatcggcat ccccgggtgc agttattgcg tcgggatgtc agccgatcag      1140
     gctgccccag gagaggtctg gatttcctct cagaatcgga atttcgaaaa ccggatgggc      1200
     aaaggttcaa ttggccacct cgcctctgca gccactgtcg cagcatcgtc ctttgaaatg      1260
     aagctggttg atcctagtga cctacttgct gcaatagatt taagcagatg gcggcagctc      1320
     acaacagcaa gcacgcactc ggatgcaact agcccaaaga gcgatctgat atatgttgag      1380
     ccatgcggtt gtgactatca tagggccggt gcccagacgc agaaacaaat agagaaaccg      1440
     cggctagata tacacggaag aggacagaca aaaagccttc aaggcaaagt acagagactg      1500
     ggagatttcg tcaacacgga tgcactcgcc cctgccgagt tcctaattgg catgaaaaat      1560
     aatatggacg ctggcctgcg ttgcctggta catacgcatc caaaattccg cgaacgagcc      1620
     caacaggggt tcaatattgt tgttggtggt aagggatttg gttgcgggtc ttcacgcgaa      1680
     caagcagtga tggcattact agggtgcggt gtccagtgtg tcatagctaa atcgttttcg      1740
     ttcatcttcc aacgcaacat gccaagcctc gggctcctgg gcatcaccat ggaagatgag      1800
     tccttctttc aagttgcaga tgatggggtg tcaatctcca tcgatttaaa ttcacgaata      1860
     attgatgtcg ctgggaagac gttcgggttc aagctcagcc aaatggaaac cgagatattc      1920
     caatttggtg ggattgcttc ggcgtttggg gtattcggaa acaagctgct cgaggcaata      1980
     accccagcca aatcgccttc aggatataaa caggaggaat cagagcagcc ggataaacta      2040
     ctacaatggt aa                                                          2052
//

If you have problems or comments...

PBIL Back to PBIL home page