(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE194

PENCW_16.PE194       Location/Qualifiers
FT   CDS_pept        join(complement(443824..443920),complement(443557..443768),
FT                   complement(443444..443508),complement(443288..443385),
FT                   complement(442505..443241))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000111120" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947781"
FT                   /orf_name="Pc20g01940"
FT                   /product="Pc20g01940 protein"
FT                   /function="cation binding"
FT                   /function="cellulose binding"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /cellular_component="extracellular region"
FT                   /protein_id="CAP85523.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0030248"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="InterPro:IPR000254"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI000183157A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE68"
FT                   /transl_table=1
FT                   /translation="MRFISLLSIAGVTGLVLAAPGPSLSKRAGSFVWFGANEAGAEFGS
FT                   GNIPGELGTDYIWPSTSTIQTLRDAGMNLFRIPFAMERLVPGTLTSSMDATYLASLKST
FT                   VNYVTSSGGYAVIDPHNFGRYYGNIITSTSDFAAFWTALASEFASNDKVIFDTNNEFHS
FT                   QDQTLVLNLNQAAINAIRAAGAKSQYIFVEGNSWSGAWTWTTVNDNMKALTDPQDLIIY
FT                   EMHQYLDSDGSGTSETCVSSTIGRERVVAATQWLKDNGKRAFLGEFAGGANPVCQSAVT
FT                   GMLDYLQANSDVWVGASWWSAGPWWGNYMYSLELPSGVGYTYYMSLLRNYFPGSTGSGG
FT                   TTTAAPTSTPTVATATKTTTTGSSTTGAAHYAQCGGKSWTGATTCASPYACQKQSDYYS
FT                   QCL"
     atgcggttta tctctttgct ttcgatagcc ggcgttacag gcctagtgct ggcagcaccg        60
     ggtccatccc tatctaaaag ggctggttcc ttcgtctggt tcggcgccaa cgaagctggc       120
     gcagagtttg ggagtgggaa cattccaggg gaactaggaa cagattatat ctggccgtcg       180
     acctcaacca tccaaaccct gcgtgatgca gggatgaatt tattccgcat tcccttcgcg       240
     atggagcggt tggttccagg aactctgaca tctagcatgg atgcgactta cctggcttca       300
     ttgaaaagta ctgtcaacta tgtcacgtcc agcggtggat atgccgttat tgaccctcac       360
     aattttggac gatattatgg caatatcatc acctctacta gtgacttcgc agccttttgg       420
     acggcccttg catcggaatt cgcatcgaat gacaaggtca tcttcgatac aaacaatgaa       480
     ttccattcgc aagaccaaac cctggtgttg aacctaaatc aagctgctat caatgctatc       540
     cgtgctgcag gagcaaaatc gcagtacatc ttcgtggagg gtaactcatg gagtggtgcg       600
     tggacatgga caactgtcaa tgacaatatg aaagccttga cagacccaca ggacttgatt       660
     atctatgaga tgcaccaata ccttgactct gacggttccg ggacatcgga gacatgtgtc       720
     agctcaacta tcggacgaga acgagtcgtg gctgccacac agtggctcaa ggacaatggc       780
     aagagggcat ttttaggtga atttgccggg ggtgccaatc ctgtctgtca aagtgcagtg       840
     acaggtatgc tcgattactt gcaagcgaat agcgatgtct gggttggtgc gtcctggtgg       900
     tccgctggac catggtgggg aaactacatg tacagtctcg agcttccttc cggcgtaggc       960
     tatacctact acatgagtct tctgaggaat tatttccccg gctcaactgg ttcgggtggg      1020
     acaaccacag cagccccaac ttccacacca actgtcgcta ctgctaccaa gaccaccaca      1080
     actgggtcaa gcaccaccgg cgcggctcac tatgcgcagt gtggtggaaa gagctggacc      1140
     ggggcaacca cctgtgctag cccatacgcc tgccagaagc agagtgacta ctattcgcag      1200
     tgcctgtag                                                              1209
//

If you have problems or comments...

PBIL Back to PBIL home page