(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE195

PENCW_16.PE195       Location/Qualifiers
FT   CDS_pept        join(complement(445024..445634),complement(444801..444927),
FT                   complement(444481..444726))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824365"
FT                   /orf_name="Pc20g01950"
FT                   /product="Pc20g01950 protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAP85524.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniParc:UPI000183157B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE69"
FT                   /transl_table=1
FT                   /translation="MTFTVAPHLNYFTIPLKDFVAARPEFEGFGVCAYIFSHADPAPRI
FT                   LLLQRALTDSMPGCWEGPGGACELDTDKTLFDSLVRETLEESGLHVSHILDLVAVDCWE
FT                   HHRRSGGKIRIAKYSFVVEVQEALGSSAGKQQAVPTLQIPVHLEPLEHQKFDWAVKEDV
FT                   LLSIRSPNGPYRFPLPLVGHQAPNILRAFELVEQRESRKECISHILRPSWCMWRYLVRY
FT                   LVYLEEAMQKPEHAPTSQATLISLCISGDFVGNLHLRRLQGSTVIPRQGNRYTVYIETY
FT                   RFPVNQAFRPPGMLCELLLMLLIMAGLVSVSIRAQFVHELVANSSR"
     atgacattta cagttgctcc ccatctgaat tactttacca tccctctcaa ggactttgtg        60
     gctgcccgac ctgaatttga agggtttggt gtttgtgcgt acattttctc tcatgccgat       120
     cccgccccgc gaatccttct tctccagcgc gcactgactg attcaatgcc cgggtgttgg       180
     gagggccccg gaggcgcatg cgaactggac accgacaaaa cgttatttga ttctcttgtg       240
     cgggagacgc tagaagaaag tggattgcat gtgtctcaca ttctggacct cgtcgcggtg       300
     gattgctggg agcatcatcg ccgcagtggc ggcaaaatac gtatcgccaa gtactcgttc       360
     gttgtcgagg ttcaagaggc cttgggatcg tcagcaggaa aacagcaagc agtgccaaca       420
     ctccaaatac ctgtccacct cgagccactg gagcaccaga aattcgactg ggcggtaaaa       480
     gaggacgttc tgctttctat tcgatcaccc aatggtccat acagattccc attgccctta       540
     gttggtcatc aagcacccaa tatcctccgg gcttttgaat tggtggaaca acgagagagc       600
     aggaaagaat gcatatccca tatcctcaga ccgagctggt gcatgtggcg ctaccttgtg       660
     cgctaccttg tttatcttga agaagccatg cagaaaccgg agcatgctcc gactagtcaa       720
     gccacgttga tttcgctttg catatcgggt gatttcgtgg ggaacttgca tttacggagg       780
     ctgcagggga gtacagttat tccccggcaa ggaaacaggt acaccgtcta tatagaaaca       840
     tatcgattcc cagttaatca agcattccga cccccaggga tgttatgcga actccttcta       900
     atgctgttga tcatggccgg tttagtatct gtttccatcc gtgcacaatt cgtacatgaa       960
     ctggtcgcga attcgagtag atag                                              984
//

If you have problems or comments...

PBIL Back to PBIL home page