(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE198

PENCW_16.PE198       Location/Qualifiers
FT   CDS_pept        join(complement(451604..452113),complement(450669..451553),
FT                   complement(450442..450616),complement(450271..450387),
FT                   complement(450140..450215),complement(450033..450084))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000251017" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977590"
FT                   /orf_name="Pc20g01980"
FT                   /product="Pc20g01980 protein"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP85527.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR012941"
FT                   /db_xref="UniParc:UPI000183157E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE72"
FT                   /transl_table=1
FT                   /translation="MEQVDVLICGSGSAGLCAATWLAKYGVRCKVLERRGGPMKMGQAD
FT                   GVQCRTVEIFESFGIGEELLREAYHVLEVNFWADNGTGAIKRTGRTADTQPGLSHQPHV
FT                   ILNQARINGLLIELMQKYNDQQIDYGYNVTDVKVDSTSAEDHDTYPVKVTAEKDGKTER
FT                   FAAKYALACDGAHSIVRKALGYKMIGDSSDAVWGVMDMVPRTNFPDIRKKSTIRSKSGN
FT                   ILIIPREGDSDNLTRFYIELAPGTNPKEVTLENLQAQAQSIFRPYRVDFVETVWWSAYA
FT                   IGQRHADFFHKDYRVFLAGDACHTHSPKAGQGMNVSLQDGYNIGWKLGEVLTGLATPSL
FT                   LETYVLERQKVAIDLITFDRYFSKLFSSGATTSPAEFQEGFIKSGKYTAGLTAKYEASP
FT                   ITSALASTNLASNVAVGMRLPSAQVVRFCDSKPLHLMKSLKSDGRWRIMAFIGDLTVLE
FT                   NRSKLNKLGDYLSAADGPIQTFTPKDQDIDSLIETIIIGHGKRHDVELEQIPECFYPVS
FT                   GKNQTRDLHKIYYDDESYNDGHGHAYEYLGIDPAQGALIIVRPDQYVSAVMGLGDHSEI
FT                   GKFFAGFLKRQTENDSSWQTSSPVGSRL"
     atggagcaag tcgatgtcct catttgcggc agcgggtccg ccggactttg cgctgctacc        60
     tggctcgcca agtatggggt acgatgcaag gtactagaac ggcggggtgg tcccatgaag       120
     atgggtcaag ccgacggtgt gcaatgtcgc accgtggaaa tcttcgaaag ttttggaatt       180
     ggggaagagc ttcttcgtga ggcttaccac gttctagagg tcaacttctg ggccgacaat       240
     ggcacagggg ccatcaagcg gacaggccgg acagcagata cccaaccggg tctatcacac       300
     caacctcacg ttattttgaa ccaggcacgt atcaacgggc tcctcatcga gctgatgcag       360
     aaatataacg accaacaaat cgactatggc tacaatgtga ccgatgtcaa agttgatagc       420
     acatctgccg aggaccatga tacctatccg gtcaaagtga ctgcggagaa ggacggaaag       480
     acagaaaggt ttgcagccaa atacgcactg gcttgtgatg gggcacacag cattgtccgc       540
     aaagccctcg ggtacaaaat gattggagac agcagcgacg ctgtctgggg tgtcatggac       600
     atggttcccc gaacgaattt cccggacatt cgcaaaaagt ctactattcg gtcaaagtca       660
     ggaaatatcc tgattattcc ccgcgaaggc gatagcgaca acctgacaag gttctatatt       720
     gaacttgcac caggaaccaa cccgaaagag gtgacgctgg agaatctgca ggcccaagca       780
     cagagcatct tccgccctta cagggtagac tttgtggaaa cagtctggtg gtcggcgtat       840
     gcgatcggcc agcgtcatgc cgatttcttc cacaaggatt accgggtctt cctcgccggc       900
     gatgcttgcc atacccactc ccccaaagcc ggccagggta tgaatgtcag cttacaggac       960
     ggttataata ttggctggaa gctcggggag gttctgactg gtctggccac tccctcactt      1020
     ctagagactt acgtcctaga acgccaaaag gtggctattg atctgattac attcgaccgc      1080
     tatttttcca agctgttttc ttctggggcc acaacatctc ctgctgagtt ccaagaaggc      1140
     ttcatcaagt ctgggaaata caccgcaggc ttgacggcca agtatgaggc ctcacccatc      1200
     acctctgcat tggcatcgac caatctcgcc tccaacgtgg ccgtcggtat gcggctgccc      1260
     agtgcacagg tcgtgcggtt ctgtgactcc aaacctctac acctcatgaa atctctcaag      1320
     tccgatggtc ggtggcgcat catggccttc ataggtgacc tgactgtgct agagaaccgc      1380
     tcaaagctca acaagcttgg agattactta agtgcggcgg atgggcccat ccagacgttc      1440
     acacccaagg accaagacat tgacagcctc atcgagacta ttatcatcgg gcatggaaag      1500
     cgtcatgacg ttgagttgga acagattccc gaatgctttt atccagtctc tgggaaaaac      1560
     caaacaagag acctacacaa gatctattat gacgacgaga gctacaatga cggacatggc      1620
     catgcatacg aatatcttgg cattgacccg gcacaaggtg ctctcatcat tgttcgacca      1680
     gatcaatatg tgtctgccgt tatgggccta ggcgatcatt cggaaatcgg caagttcttt      1740
     gccgggtttc tcaaacgcca aacggagaac gattccagtt ggcagacgtc cagtccagtg      1800
     ggcagcagat tatga                                                       1815
//

If you have problems or comments...

PBIL Back to PBIL home page