(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE199

PENCW_16.PE199       Location/Qualifiers
FT   CDS_pept        join(complement(453715..453868),complement(453274..453661),
FT                   complement(452887..453218),complement(452537..452826))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172696" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977591"
FT                   /orf_name="Pc20g01990"
FT                   /product="Pc20g01990 protein"
FT                   /function="RNA binding"
FT                   /function="RNA-directed DNA polymerase activity "
FT                   /biological_process="RNA-dependent DNA replication "
FT                   /protein_id="CAP85528.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003964"
FT                   /db_xref="GO:0006278"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniParc:UPI000183157F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE73"
FT                   /transl_table=1
FT                   /translation="GKYEXLTIPFRLYNTLATFXILINKTLXLFLGRIVVIYLDDILVF
FT                   LDTEDKYYKHLEEVLKCLRKXKLYAKPKKCILITIELEFYSYIISNREVRLLPEKLEAI
FT                   IGXLRLININEVRRFIRLVLYYRRFIYSFSEIAAPLYNLTKEANKELYKKRFRPINXIE
FT                   XCEVTFRRLKEVLISAPILIXLDXAKPFIIETDTLEXAISFVLGXEAKDRKVYLIAFDS
FT                   RKLRAAELNYLVYKKELLVIKEALRIXDRYLENGTTTTIIIDYKGLXYLTTI"
     atgcctgaga gcaagattcc ccaaccgggt cctgccaaac ttaagcgcaa tgcgggtcct        60
     gacgagtggc tggaggccgc gaaggattgc aagtatctat cagagccaca tatgaagcag       120
     ttgtgtgaga tcgtcaagga atacatgatg gaggaatcaa atatccaacc agtctcgaca       180
     cccgtcacgg tctgtggtga cattcatggc caattctacg atctcttgga actcttccga       240
     gtttctggag gcatgcctga tggtacagaa ctcgaccccc cgaagacatc cccctctgtc       300
     attacctccg ccgatattga acccccgtcg agcatctcag accctaaaat tcgcaagaag       360
     cttcgcggtc ccaccgtgaa ttccaatgat gaggaggaag attcgagttc gcgaagccga       420
     tcggctagcg atacatctgc agatctccag cttaaccgca actttgtatt tctgggtgac       480
     tacgtggacc gtggatattt cagtctggag acgttaacgc ttttactttg tctcaaagca       540
     aagtatcccg atcgagtcac attggttcgt ggtaatcacg agtcgcgcca aattacccag       600
     gtatacggtt tctacgaaga atgcttccaa aagtacggta gtgcttcagt atggaaggca       660
     tgctgccagg ttttcgattt catgacattg ggggccatta ttgacggcaa ggtgctgtgc       720
     gttcacggcg gcctgagccc tgaaattcgc acactggacc aagtccgcgt ggtagcccgc       780
     gcacaggaga ttcctcacga gggtgccttc tgtgatcttg tgtggtctga cccagatgac       840
     gtggagacgt gggctgtcag tcctcgggga gcgggatggt tattcggaga cagagtggcc       900
     gatgagttct gccatgttaa tgatctctcg ttgatcgcac gcgctcatca gttggtcaac       960
     gagggctaca aataccactt taacaaccaa aatgtggtca ccgtgtggag tgcgccaaat      1020
     tactgctacc gatgcggaaa cctggcctcg gtctgtgaaa tcggagagga tctcaaaccc      1080
     acattcaagc tgtttagtgc agttagcgat gaccagagac atgttccaac ttcgcggcca      1140
     ggacgcagcg agtacttttt gtaa                                             1164
//

If you have problems or comments...

PBIL Back to PBIL home page