(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE2

PENCW_16.PE2         Location/Qualifiers
FT   CDS_pept        join(complement(4619..4831),complement(4432..4586),
FT                   complement(4116..4212))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977326"
FT                   /orf_name="Pc20g00020"
FT                   /product="Putative uncharacterized protein Pc20g00020 "
FT                   /protein_id="CAP85331.1"
FT                   /db_xref="UniParc:UPI0001831829"
FT                   /db_xref="UniProtKB/TrEMBL:B6HER1"
FT                   /transl_table=1
FT                   /translation="MGTDDHVRQYNAENSRYFSPHIRLHNPGGSGLAQGMLRVSSGLAQ
FT                   GWLKVGSRLAHGWLTVGSRLAHGWLRGMLRVSSGLAQGMLRVSSGSAQGWLKVGSRLAH
FT                   GWLTVGSRLAHGWLTVGSGSINDHASINKELWHCHRVPAAQKSRSKNGKR"
     atgggtactg atgaccatgt acgacaatac aatgcggaga actcgcggta tttttcgcct        60
     catatacgat tacataatcc cggcggctca gggttggctc agggtatgct cagggtaagc       120
     tcagggttgg ctcaaggttg gctcaaggtt ggctcaaggt tggctcacgg ttggctcacg       180
     gttggctcac ggttggctca cggttggctc aggggtatgc tcagggtaag ctcagggttg       240
     gctcagggta tgctcagggt aagctcaggg tcggctcaag gttggctcaa ggttggctca       300
     aggttggctc acggttggct cacggttggc tcacggttgg ctcacggttg gctcacggtt       360
     ggctcagggt caatcaatga ccacgcaagc atcaataaag aattatggca ttgccatcgc       420
     gtccccgctg ctcaaaagtc ccgtagcaaa aatggaaaga gatag                       465
//

If you have problems or comments...

PBIL Back to PBIL home page