(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE20

PENCW_16.PE20        Location/Qualifiers
FT   CDS_pept        join(59860..60643,60718..60824)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000100368" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946678"
FT                   /orf_name="Pc20g00200"
FT                   /product="Pc20g00200 protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAP85349.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniParc:UPI000183190C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF31"
FT                   /transl_table=1
FT                   /translation="MSPRLGGLLQLSPVWGAPLITPRIPVRSFGIRSLNPPKPSRFNIG
FT                   PGLPVLESTSTAALRRKANSLPLRTGAIGIKKGMTAIYDPESGKRIPCTVLQLDRVEVI
FT                   SHKTRERHGYYAVQVGAGWKHPSNVTKSMLGHFSVNGISPKRHIFEFRVKDEAGLIPVG
FT                   QSIEAGWFQEGQFVDARSNTKGKGFAGVMKRHGFGGQDRSHGVSLTHRSMGSSGPGQGG
FT                   GSRVYPGKKMAGNMGNTQNTVQNLKILKVDSENGIVVVSGAVSGPKGCVVRIQDAIKKP
FT                   WPEVPQAEATEPATA"
     atgtcgccgc gcttaggagg gctacttcag ctctcacccg tatggggtgc cccgttgatc        60
     acgccccgga tccccgtgcg ctcattcgga atccgatctc tcaacccgcc caaacccagt       120
     cgtttcaata tcggacccgg gctgccagtc ctcgaatcga cgtcgacggc ggcgctccgc       180
     cgcaaagcca attccctccc gctccgcact ggagctatcg gtatcaagaa gggcatgact       240
     gctatctacg atcctgagtc tggaaagcgc atcccctgca ctgttctcca gctggatcgt       300
     gttgaggtta tttcccacaa gacccgcgag agacatggtt actatgctgt gcaggtcggt       360
     gctggctgga aacacccgag caacgtgacc aagtcgatgc ttggacattt ctcggttaat       420
     gggatctcgc ctaagcgcca tatctttgag ttccgcgtta aggacgaggc gggcctcatc       480
     cctgttggtc agagcatcga ggcgggttgg ttccaggagg gccagtttgt tgatgctcgc       540
     tccaacacta agggtaaggg ttttgctggt gtcatgaaga gacacggctt cggcggtcag       600
     gatcgcagtc acggtgttag tttgacgcat cgttcgatgg gttcttctgg tcctggtcag       660
     ggtggtggtt cccgtgttta ccccggaaag aagatggccg gaaacatggg caatactcag       720
     aacactgttc agaacttgaa gattctcaag gtggattctg agaatggtat tgtggttgtc       780
     agcggtgctg tcagtggtcc caagggctgt gttgtgagaa tccaggatgc gatcaagaag       840
     ccatggccgg aagtgccaca ggcagaggcg acggaacctg ccactgctta a                891
//

If you have problems or comments...

PBIL Back to PBIL home page