(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE203

PENCW_16.PE203       Location/Qualifiers
FT   CDS_pept        join(complement(461045..461084),complement(460552..460993),
FT                   complement(460231..460492),complement(460007..460179),
FT                   complement(459645..459954),complement(459153..459593))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216587" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671677"
FT                   /orf_name="Pc20g02030"
FT                   /product="Pc20g02030 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP85532.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR002409"
FT                   /db_xref="UniParc:UPI0001831583"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE77"
FT                   /transl_table=1
FT                   /translation="MQGFGRNGPRSKSGCSTCRRRKVKCGEEKPVCARCSSLRLNCEWG
FT                   VPVKRGRSTQIRHLEPAPETSEQPSWPTPKAEDLVGFQPDALFASPSPVSWASDALPFD
FT                   TFNPVPIPTPICPSLNVNVACANSLTLTSLDRQYFQYFPSSSLVFYYMKRWKWSSLCHL
FT                   YEGPAASNRIIMRMILALSACDMHRNGLIVRSQDHGRYHYSQAVKEFRQLLETPRQVSL
FT                   DDVGTVFATVFLMIAWEWQFGNSVRHLQLHLQGVRSLLETHPQLFRIKDVNDMFCSPGV
FT                   NTLASDSGTMAKVSFIPEQLLLWILYIDASCRPIGLTDSLNDYVAQTGNPALQPDHLYR
FT                   CARLWGRCFWGEQYPDEEVLDDIENYRALELLHVGFCLRHRTWQVLVESAAGTAESAEA
FT                   LFREILATRETFSDLFITARFAGSVSARRTLNTIYMAVSTFYGQVLLHRRLLCVDSLPL
FT                   GIHQQATAGIIDICQKQFLSDPRLLRRLHWPLLMAAIETNDITHQSWLRQRLWELRDFH
FT                   SEFIWAHDVAEQVLALQDVGQGRYINLADFLLKRFHAR"
     atgcagggct ttggacgtaa tggaccacgt tccaagagtg gttgtagtac ctgtcgccgt        60
     cgcaaggtca agtgcggtga agagaaacca gtctgtgcaa gatgttcatc cttgcgcctc       120
     aattgtgagt ggggtgtccc ggtgaagcgt ggacgaagca cgcaaatccg gcacctcgaa       180
     cctgcaccgg aaacctccga acaaccctca tggccgacgc ccaaagctga ggaccttgtc       240
     ggctttcaac cggatgccct ttttgcaagt ccctcgccgg tctcctgggc atccgacgct       300
     cttccctttg atacgttcaa tccggtgcca atcccgaccc ccatatgccc ttccttgaac       360
     gtcaatgtcg cgtgcgccaa ttcattgaca ctcacctccc ttgatcgaca atacttccag       420
     tacttccctt cttcctcgct cgtattttac tacatgaaga gatggaagtg gagcagctta       480
     tgccaccttt acgaaggtcc agctgcttca aatagaataa taatgcggat gatactggcg       540
     ctaagtgcat gtgatatgca tcgcaatggg ctgattgtac gctctcaaga tcatggccgg       600
     taccattaca gccaggcggt caaagaattc aggcaattgc tcgagacgcc gcgccaggtt       660
     tcattggatg atgtcgggac ggtttttgct actgtttttc tgatgatagc ttgggagtgg       720
     cagttcggga actcagtgcg ccatcttcaa ctccacctcc agggcgtacg ctcgcttctg       780
     gaaacacacc cgcaactatt ccgcatcaaa gatgttaatg atatgttctg ctctcccgga       840
     gtaaatacat tggccagtga ttcagggacc atggccaagg tctccttcat ccctgagcag       900
     cttttgttgt ggattctgta cattgatgct agctgccgtc ccattggtct taccgattca       960
     cttaacgact atgtggccca gactgggaat cccgctttgc agccggacca tctttatcgt      1020
     tgtgcccgtc tctggggccg atgtttttgg ggcgagcaat atcccgacga ggaagtcctg      1080
     gacgatattg aaaactacag agctttagag ctactgcatg tgggattttg cctacgccat      1140
     cggacttggc aagtcctcgt cgagtccgcg gctggtaccg ccgagtccgc agaagccctt      1200
     ttccgtgaga tcctcgctac ccgagaaaca ttctccgacc tttttatcac cgcgagattt      1260
     gcgggtagtg tgtccgctcg acgtacgctc aataccatat acatggccgt ttctaccttc      1320
     tacggccagg tcctcctcca ccgtcggctt ctctgcgtcg attctttgcc tctaggcatc      1380
     caccaacaag ctaccgcagg gatcattgac atctgtcaaa aacaattctt gtctgacccg      1440
     aggctccttc ggcggttaca ctggccgctg ttgatggcag cgattgaaac caatgatata      1500
     acgcatcaaa gctggctccg tcagcgtcta tgggaactgc gcgactttca ttccgagttt      1560
     atttgggcgc atgatgtggc cgagcaggtc ctagccctgc aagacgtggg ccagggacgg      1620
     tatatcaatc tggccgattt tttactaaag cgctttcatg cgcggtga                   1668
//

If you have problems or comments...

PBIL Back to PBIL home page