(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE204

PENCW_16.PE204       Location/Qualifiers
FT   CDS_pept        join(complement(462827..462922),complement(462385..462767),
FT                   complement(462240..462328),complement(461873..462176),
FT                   complement(461685..461812),complement(461387..461622))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000251261" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671678"
FT                   /orf_name="Pc20g02040"
FT                   /product="Pc20g02040 protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAP85533.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010168"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017144"
FT                   /db_xref="UniParc:UPI0001831584"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE78"
FT                   /transl_table=1
FT                   /translation="MTLTTINIEEVKTSVDAALEALQQDLRELNHRIWSNPELAYEEHR
FT                   AHDTICDFLEGQGFTVTRHAYGLETSFEVLSGTGGRLVNFNAEYDALPGIGHACGHNLI
FT                   ATSSIAAFLALSFAISKFNIPGRAQLLGTPAEENGGGKAKLIDAGAYKNVDISLMAHPG
FT                   PKKIYPDQEPSDGIAGTPMNARKNIHCEFTGRNAHAGGNPWEGINALDALVSSYNNVAV
FT                   LRQQLLPDQRVHCAFLDTPKVANVIPDYTKAFWQVRSPTLKGLNALVGKLRNCIEAGAL
FT                   ATGCQVKIEENELYTDVRLNDTLCERYQVHMGRYSRNVLKRHDKVLTGSSDIGNVSYET
FT                   PTLHTMFAIPAPATSFPHHPTFAAAAGTDEAHAEALIVGKSLALIGWDMIVENDMYDLA
FT                   RRQWKDEIVREE"
     atgactctca caaccatcaa tatcgaggag gtgaagacct ctgtcgacgc cgcactggag        60
     gcactacaac aagacttgcg ggaattgaac catcgaatct ggtccaaccc agagcttgct       120
     tacgaggagc accgcgccca tgatacaatt tgtgacttcc tcgaaggaca aggcttcacc       180
     gttactcgcc atgcttatgg gcttgaaacc tcttttgagg ttttgagtgg aaccggtggg       240
     agattggtca atttcaacgc agaatatgac gcactacctg gaatcggcca tgcctgtggt       300
     cacaatctca tagcgacaag cagtatcgct gcgtttcttg cgctgtcatt tgccataagc       360
     aaatttaaca tccctggtag agcccagctg ttaggcactc cggccgaaga aaatgggggc       420
     ggaaaggcca aattgattga tgccggcgct tacaagaatg tcgacatttc gctgatggct       480
     catcctggac ccaaaaagat ttatcccgac caagagccat ccgatggcat agctggaacg       540
     cctatgaacg cgcggaagaa tattcattgc gaattcacgg gtagaaatgc tcatgctggt       600
     ggaaacccgt gggaagggat caacgcgctt gatgctctag tctcgtctta caacaacgtt       660
     gcggttcttc gacagcagct tcttccggat caacgtgttc attgtgcttt cttagatacg       720
     cccaaggtag caaacgtgat accggattac acgaaggctt tctggcaggt gcgcagccct       780
     accttgaagg gactgaatgc ccttgttggc aaattgcgca attgcattga ggctggtgcg       840
     ttggccacgg gatgccaagt caagattgag gagaacgaac tctataccga tgtccgattg       900
     aatgatactc tctgtgaacg ctatcaggtc cacatggggc gctatagtcg caatgtcctt       960
     aagcgccatg acaaagtcct aacaggatcc tcagatattg gaaatgttag ctacgagacc      1020
     cccacgcttc atacaatgtt tgcgattccg gcccctgcaa cttcattccc acatcaccca      1080
     acgtttgcag cggccgctgg aacagatgaa gcgcatgctg aggcattaat cgttgggaag      1140
     tctttggcat tgatcggttg ggacatgatt gtggagaacg acatgtatga tttggcgcgg      1200
     cgccaatgga aagatgagat tgtacgggag gagtag                                1236
//

If you have problems or comments...

PBIL Back to PBIL home page