(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE205

PENCW_16.PE205       Location/Qualifiers
FT   CDS_pept        join(464643..465029,465165..466592)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947785"
FT                   /orf_name="Pc20g02050"
FT                   /product="Pc20g02050 protein"
FT                   /function="exonuclease activity"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP85534.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004527"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR006055"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000183166D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE79"
FT                   /transl_table=1
FT                   /translation="MDRKSEYHRGDLQALEHVEYPCPVCKDRMYETEQGFTDHLRNDHQ
FT                   IFSCSKCEKIFAAADELLRHKVEAGHTVPPKTKRKAKSRSPVKSCERARQLPKSPMHLS
FT                   TQETTASKGNDTDRRAQETPATPSTEVTIAPHQAVSLRVRMRSTLPTERDFIFNTSIDH
FT                   VDIACQLVDAGFTTLHAYNTSNATQTILRRAKIGYLEEADYTTAYEAEPNASALCFPPR
FT                   RYDTSHPRPVVIPDIPEHAPKQTKLPNGVTVYGDPDTVAKLAQVVNEFDIWARPGRKPG
FT                   LVNIPKERWMRLRLKPGVTLPRTQVYKLAPRAQNLLDTTFDKLHDEGKMSWATTGCHSL
FT                   ARLHCQGYTTPKTIRTAACTKRGEPHQAHTFTGGSAHRKAIVIACEMIETTVSTSVLAF
FT                   ITAIDFLTGEVLINSYVAPTAPVTNWLTPVTGITPEAMEAAIADGKAFLSNDAVRRALD
FT                   KFLDKDTVVIGHAIQHDLRALNLLHGRIVDISVVTAEAVFSNFSSKTTLPRIWELKTLA
FT                   KELRGIDIQPGLAHNPLEDAVATREVLIWCLRGPECLKAWAEKARSSYERVRLQRGENK
FT                   KGTKNVEKKAGGETVPSAKAQGKKRFSK"
     atggaccgca aatcggaata ccaccgaggt gacctccagg cactggagca tgtggagtat        60
     ccatgtcctg tgtgcaagga tcgaatgtac gagacagaac aaggtttcac tgatcatctg       120
     agaaacgacc accagatatt ctcatgttca aaatgcgaga aaatctttgc ggccgcagat       180
     gagttgcttc gacacaaggt cgaagcagga cacaccgtgc cccccaaaac caagcgcaaa       240
     gccaaaagcc ggtccccagt gaagtcatgt gaacgagcga ggcaacttcc caaatcgccg       300
     atgcatctat ccacacagga gactaccgca tctaagggaa acgacacgga caggcgggcg       360
     caagaaacac cagcaacacc atcaacggaa gtcaccatcg ctccccacca ggccgtcagc       420
     ctccgcgtcc gtatgaggtc cacgctacca actgaacggg atttcatttt taatacttct       480
     atcgatcatg tcgatattgc ttgccagttg gtcgacgcag gcttcaccac cttacacgcg       540
     tataatacca gcaacgccac ccagacaatc ttgagacggg ccaagattgg ctatctggag       600
     gaggctgact ataccacggc ctacgaggca gagccaaatg cctccgcgct ttgtttcccg       660
     ccccggaggt acgacacgtc gcacccaaga ccggtggtaa tccctgacat ccccgaacac       720
     gcccctaagc agacaaagct tccaaacggc gtcaccgttt atggtgaccc cgacacggtc       780
     gctaagcttg ctcaggtcgt caacgagttc gatatatggg cccgtcccgg gcgcaagcca       840
     ggtctagtta acatcccgaa agaacgctgg atgagactac gattgaagcc aggcgtcacc       900
     ctaccccgta cacaggtcta caagctggca ccacgggccc agaacctcct ggataccacc       960
     ttcgataagc tgcacgacga agggaagatg tcctgggcca ccaccgggtg ccactcactg      1020
     gcccgtctcc attgccaggg ctacacaact ccgaagacca tccgcactgc agcctgcacg      1080
     aagcgcggcg agccacacca agcgcacact ttcactggcg gctccgcgca tcgaaaagcc      1140
     atcgtgatag cctgtgaaat gatcgaaaca acagtcagca ccagcgtcct ggccttcata      1200
     acggccatcg atttcctgac aggtgaggtc cttatcaaca gctacgtcgc gccaacggcg      1260
     cctgtcacaa actggctgac tccagtcact ggcattacgc ccgaagcaat ggaggcggcg      1320
     atcgcggatg gcaaggcctt tctatcgaat gatgctgtgc gccgtgcgct ggacaagttc      1380
     ctcgataaag atacggtggt cattggtcat gcaatccagc atgacctgcg tgctctaaac      1440
     ttgttgcatg gtcggattgt tgacatctct gttgtcacag ccgaggctgt gttctccaac      1500
     ttttcttcca agacaacgct tccccggatc tgggagttga agacccttgc aaaggagctg      1560
     cggggtatcg atattcagcc tgggttggca cacaatcccc ttgaggatgc agtggcaacc      1620
     agggaagttc tgatctggtg tctgcgtggc cctgagtgtc tgaaggcctg ggctgagaag      1680
     gctcgtagct cgtacgagcg ggtgcggctc cagagagggg aaaacaagaa ggggacgaag      1740
     aatgtggaga agaaggctgg tggtgaaact gtcccctcgg ccaaagccca gggcaagaag      1800
     cgcttctcca aatga                                                       1815
//

If you have problems or comments...

PBIL Back to PBIL home page