(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE206

PENCW_16.PE206       Location/Qualifiers
FT   CDS_pept        join(complement(469816..469891),complement(467201..469659))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194972" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824367"
FT                   /orf_name="Pc20g02060"
FT                   /product="Pc20g02060 protein"
FT                   /protein_id="CAP85535.1"
FT                   /db_xref="UniParc:UPI000183166E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE80"
FT                   /transl_table=1
FT                   /translation="MGCSSSCGKPQPSQLTSHLALRPVSPESVTQTLTLSSNPRFHQPF
FT                   LEVPRHTPKVFDEAHDSYDPSTLTTFARQRSPTVERPSTSADHQLRPPSASGSQRPLRR
FT                   IPRQTEVRQSLRRESLRAPVPHPNRPQPPRTTPVSVQVQHAPASGIAELRPALSEAATD
FT                   DNGSTIDDPYQLLNTSYWPQRTTRVSTRTASAILFALEEAIRGPLQLSTDWDEVNASMS
FT                   DMVGVAGPAGPVGNSRVQNGGARVPQNPISGTSQPPSGMRTPTDIMRQRRDREARRKAE
FT                   HEAREREQEELERQQLEQEQLAQAEAQAQTQAQAQAQQYAGVAADNTSQPRTRVPRPSR
FT                   GPEGQAPTVPVTSSGYRPAADAAPSTRPSEHQTAPLTATTGPMPNQSRLAQATGQQPQH
FT                   GRSQSAAENGGQPKPSAFSKSAQALPAGQPGAPQALQQPKRVGFPHAFERWETLSSHWE
FT                   GLTGYWMRKLEQNNEDLERDPLSQQLARQITDLSAAGANLFHAVVELQRLRASSERKFQ
FT                   RWFFDTRAEQERSKEVQADLNRQLKEERQGRADAFSAAQEAEKDKVKAEGLLKEMRREL
FT                   QISKEEARRAWEELGRREQEERDRTNSLRNGEPTLVGGVQVVPMVSGLPSRQNTTRPQT
FT                   RDGAYPGGQAATSMGTDAYGKSAGSTGGQYYEDGTPMSPTGSDPFIEPKKVDPPTSKAP
FT                   YPGPLYEHENPTVPYPGPATSEPDARSYVGSSEAGDEEYAHYSQDPHGNTFSYPPGPPS
FT                   EGSEEYDQSLQEGHYMPDGAYTSAASTIPPPAPASAADYTGAGWGPGTGWESVTPRHRH
FT                   PTRLSDVLEEDEPSRTNPSRATSRSQASRSIL"
     atgggctgca gctcgagctg cggcaaaccc cagccatctc aattaaccag ccacctcgca        60
     ctccgacccg tttctcctga atcagtgacg caaacactca cattgtcgtc caatccacga       120
     tttcaccaac cattcttaga ggtgcctcga cacaccccga aagtgtttga cgaagctcac       180
     gactcttacg acccatcaac gttaacgacc tttgcgcggc aacgctcgcc cactgttgaa       240
     cggccttcta cttcagccga tcaccaattg agacccccga gtgcttctgg ctctcagcgt       300
     cccttacgtc gtatccctcg ccagacagag gtccgccaat cgctccgtcg agaatcttta       360
     cgcgccccgg ttccacaccc taaccgaccc cagccgccgc gtacaacccc ggtctctgtg       420
     caagtgcaac acgccccagc cagtggcatc gcagagctac gtccggccct ttccgaagcg       480
     gcgaccgacg acaacgggtc tacaatcgac gacccgtacc agctcctcaa cacatcatac       540
     tggccgcagc gaaccacccg agtctcgacg cgcaccgcgt cagcaatcct tttcgccctc       600
     gaggaagcca tccgtggacc gctgcagctc tctactgact gggacgaggt gaatgcttct       660
     atgtcagaca tggtaggcgt cgctggtccc gctggacctg tgggcaacag ccgggttcaa       720
     aatggtggag cccgtgtgcc ccagaatccc atctcaggga catcacagcc acccagtggt       780
     atgaggacac ctacggatat aatgagacag cgccgggatc gggaagctcg ccgcaaagcg       840
     gaacacgagg ctcgagagag ggaacaggaa gaactggaac gacaacaact ggagcaagaa       900
     cagctggctc aagccgaggc ccaggcccag acacaggccc aggcccaagc tcaacagtac       960
     gctggcgttg ccgccgacaa tacctcccaa ccaagaacta gagtcccccg accatcaagg      1020
     ggccccgaag gacaggcccc gaccgtgccc gtcacatcct ccggttaccg accagcagca      1080
     gatgctgcgc caagtactcg accatcagaa caccagaccg caccactgac tgctacgacg      1140
     gggccaatgc ctaaccagtc acggctggca caagcaactg ggcagcagcc tcagcacggc      1200
     cgctcgcaga gtgcggcaga aaatggaggt cagccgaaac ccagtgcctt ctccaaatct      1260
     gcccaggccc tacccgcagg acagcctggt gctccccaag ctcttcagca gccgaagcga      1320
     gttgggtttc cgcatgcatt tgagcgatgg gaaacgctgt cttcacactg ggagggcctc      1380
     accggctatt ggatgcgcaa gctcgaacaa aacaatgagg atctagagcg tgatccactc      1440
     agccagcaat tggctcgaca gattacagac ttgtctgccg ctggtgccaa tctattccat      1500
     gcggtggttg aactgcaacg tctgcgagcc tcctccgaac gcaagttcca gcgctggttc      1560
     ttcgacaccc gtgctgagca ggaacgctcc aaggaagtgc aggcggacct caaccgccag      1620
     ctgaaagaag aacgccaagg ccgagccgat gccttttctg ccgcccagga agccgaaaag      1680
     gacaaggtca aggctgaggg gttgctgaaa gagatgcgcc gcgaactcca gatttccaag      1740
     gaggaagcac gccgtgcctg ggaggagctt ggccgtcgtg aacaggaaga gcgagaccga      1800
     accaactccc tgcgcaacgg agagcccaca cttgttggag gtgttcaggt tgtgcctatg      1860
     gtttctgggc tccctagtcg tcagaacacc acacgcccac agacccgcga cggggcatac      1920
     cccggcggac aagcagccac atccatgggc accgacgcat acggcaagtc cgcagggagc      1980
     acaggcggac aatactacga agacggcacg ccgatgtctc ccaccggatc ggaccctttc      2040
     atcgagccca aaaaggttga cccacctacc tcaaaagccc cttatccggg tccactgtat      2100
     gaacacgaga acccaactgt cccataccca ggcccggcaa cctcagaacc cgacgcgcgt      2160
     tcctacgtcg gcagcagcga agcgggcgac gaggaatatg cacactactc ccaagacccg      2220
     cacggtaaca cttttagcta cccacctggt cctccctcag agggaagcga ggagtatgac      2280
     caatccttgc aagagggtca ctacatgcca gacggcgcgt atacctctgc cgcctctacc      2340
     atccctccgc ctgcgccggc ctccgctgcg gactataccg gcgccggctg gggacctggc      2400
     actgggtggg agtccgtgac accgcgccat cgccacccca cgcgtctgag cgatgttctt      2460
     gaggaagacg agcctagtcg cacgaatccg agccgcgcta caagtcgtag ccaggccagc      2520
     cggagtatac tttaa                                                       2535
//

If you have problems or comments...

PBIL Back to PBIL home page