(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE207

PENCW_16.PE207       Location/Qualifiers
FT   CDS_pept        join(470882..471043,471178..471343,471473..471534,
FT                   471623..471669,471716..471735,471765..472065,4
FT                   72164..472230)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128702"
FT                   /orf_name="Pc20g02070"
FT                   /product="Putative uncharacterized protein Pc20g02070 "
FT                   /protein_id="CAP85536.1"
FT                   /db_xref="UniParc:UPI000183166F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE81"
FT                   /transl_table=1
FT                   /translation="MAKMLYNIHIHATVAPFPRNDIASRMFRGPRSKANLESKFRFFKF
FT                   NKNLRSNKKAVAEALEETRTTAAIPGFEVREATIQSREEIRGRYGVDLCSSLHIPNLGF
FT                   ISANNMSVQAKVLTEFRRDELKRRARVKPYSRAEGSVLMPKCYVGSNTSTPNSNTSSQE
FT                   ALNTTPHRDRNETPKQTEASTTEYGGRNTTSKVICTPCSKAWTSGAKGQQGPRNRKIRY
FT                   LNRAGEGLPAARTHEQKPAMSPERSGNPVLRVLELGAIGQRKYVLQDNSGDS"
     atggcgaaga tgttgtataa tatccatata catgcaactg ttgcgccgtt tccccgcaat        60
     gacatcgcct ccaggatgtt ccggggcccg aggtcgaaag cgaacctgga aagtaaattc       120
     aggttcttca aattcaacaa gaatcttaga tcaaataaaa aggccgtcgc ggaagccctc       180
     gaagagaccc gtaccaccgc ggcgatcccc ggctttgaag tgcgcgaggc gaccattcaa       240
     tctagagagg agatccgggg aagatacgga gtcgacttat gctcctctct acacataccc       300
     aatttggggt ttataagtgc aaacaacatg tctgttcaag caaaggtcct tacagaattt       360
     cgtagagatg aattgaaacg aagagcaaga gtaaagccct attctcgcgc cgaaggctcg       420
     gtgctaatgc caaaatgtta cgtgggcagt aatacatcta cccccaattc caatacctca       480
     agccaggagg ccctcaatac aacaccccac cgtgaccgca acgagacacc taaacaaaca       540
     gaagcaagca ctacggagta cggagggcgg aatacaacct caaaagtaat atgcaccccc       600
     tgttcaaagg cctggacctc aggagcaaaa ggacagcaag ggcctaggaa tcggaaaatt       660
     cgatacctca atcgggccgg ggaagggctt cccgcagcgc ggacgcacga acagaaaccc       720
     gcaatgtctc cagaaaggag cggaaaccca gtactgaggg tcttggaatt gggagctatt       780
     ggccaacgga aatatgtttt gcaagacaac tccggggatt catga                       825
//

If you have problems or comments...

PBIL Back to PBIL home page