(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE208

PENCW_16.PE208       Location/Qualifiers
FT   CDS_pept        474298..475998
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194782" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947786"
FT                   /orf_name="Pc20g02080"
FT                   /product="Pc20g02080 protein"
FT                   /protein_id="CAP85537.1"
FT                   /db_xref="UniParc:UPI0001831670"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE82"
FT                   /transl_table=1
FT                   /translation="MDQRGLYCPGELDVLHQDRNRSETTICLPSPSPAKRASSYYPAGP
FT                   KVLEESNLDPFYLEESLAATPSWNPYTSDMRNDSFEDEDQYYTLSLTHKDIHHPSQYGP
FT                   DRSTLAQVELENSLRFHRYTSSTEEHSPLHSSQVSFSSVHTDSTTPDLTPSSSFSSSYD
FT                   SPSCPDAVLEATQQLYKHANQVQIEPRRRFYLPASTPPTYSLPPPPPPPVAPLNPADTR
FT                   PTTPCFQHSNDSTTTITMGYEDTTASCSSRSRRRKQPPSGLTLSRTASSPSTSRRKQSS
FT                   PGTRPPLDPSMISPPSLINPVTMEPHMTHFDHPLFIPANDCPSPVPSPVASSAPISRQW
FT                   TATSMERPSISTIDAFCEQSVWESDSDSESAGRKSMSRRPIDTLRKVRSRAKLRAAKSQ
FT                   PKLHQAMLDGQTCEQFPCMPEDILGEPIPEAFRPSMDRPSTSKEAVRAHSGLQTLRLVA
FT                   PSSASLTRSRSRKNSSLNSSDVDRSAAAAFQAQFRRRQRSDSPEYSNSSSDKGDKEKLT
FT                   SFCYDQYSHTPTNGAREQRPLFERFMNSLRSLNCQKPQKSHKKTNVTTI"
     atggatcaaa gaggtcttta ttgtccaggc gagttggacg tcttgcacca agatcggaat        60
     agatcagaga ctacaatctg tctcccatcg ccctcacctg caaagcgggc atcctcttac       120
     tacccggctg gcccaaaggt cctggaagaa tcaaatctcg atcccttcta cctcgaagaa       180
     tcactggctg ccacgccatc ttggaatcct tacacatcgg acatgcgcaa tgatagcttt       240
     gaagacgaag accagtacta caccctgtcc ctgacccaca aggacatcca ccacccatca       300
     caatacggac cagatcgctc cacacttgcg caggtggagt tggagaacag cttgagattc       360
     caccgataca cttcctcgac ggaggaacac agtccgctgc acagcagcca ggtctcgttc       420
     agctccgttc acacagacag cactactccc gacttgaccc ccagcagttc tttttcttca       480
     tcctacgatt cacctagctg ccccgacgcc gtcttggagg cgactcagca gctttacaag       540
     cacgcaaacc aggtccagat tgagccccgt cgccgcttct atctgcctgc ctctacacca       600
     cctacgtact cccttccgcc tccacctcct ccgccggtgg ctcccctcaa cccggcggat       660
     actcgcccaa ccacaccttg cttccaacac tcaaacgact ctactactac catcaccatg       720
     ggctacgagg acactacagc atcctgctca tcgcggtccc gccgccggaa gcagcctcct       780
     agcggtctca ctctgtcgcg taccgcgagt tcccccagca cgtctcgtcg gaagcaatcc       840
     agccctggaa cccgccctcc tctggatcct tccatgatct ctcctccatc cttgatcaac       900
     ccagtcacca tggagcctca catgacccat tttgaccacc ctctcttcat tcccgccaac       960
     gactgcccta gtcccgtccc tagtcctgtg gctagctccg cacccatctc ccgccagtgg      1020
     accgcaacct cgatggaacg cccttcaatt tctaccatcg acgccttctg tgagcagtcc      1080
     gtgtgggagt cggattccga ttcggagtct gctgggcgta aatctatgtc tcgtcggcct      1140
     atagacacac tccgcaaggt tcgcagccgt gctaagctcc gtgccgccaa gtcacaacca      1200
     aaacttcatc aggctatgct ggatggtcag acatgtgagc agttcccatg catgccagag      1260
     gatattctcg gagagcctat tcccgaagcc ttccgtccca gcatggaccg tcccagcact      1320
     agcaaagaag cggtgcgagc acatagcggg ctgcagacgt tgcgtcttgt cgctccttcc      1380
     tccgcctctc taacccgctc tcgttcccgc aagaacagca gtctcaatag ctccgacgtt      1440
     gaccgatccg cagctgccgc tttccaagct cagttccgcc gtcgtcagcg ttccgactcc      1500
     cccgaatact ccaactctag ctctgacaag ggtgacaagg agaaattgac ctcgttctgc      1560
     tatgaccaat actctcacac tcccaccaat ggagctcgtg agcaaaggcc tctcttcgag      1620
     cggttcatga actccctgcg ttcgttgaac tgccagaagc cccaaaagtc tcacaagaag      1680
     accaatgtta ccaccatctg a                                                1701
//

If you have problems or comments...

PBIL Back to PBIL home page