(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE209

PENCW_16.PE209       Location/Qualifiers
FT   CDS_pept        complement(478705..479391)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048414" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947787"
FT                   /orf_name="Pc20g02090"
FT                   /product="Pc20g02090 protein"
FT                   /protein_id="CAP85538.1"
FT                   /db_xref="InterPro:IPR019191"
FT                   /db_xref="UniParc:UPI0001831671"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE83"
FT                   /transl_table=1
FT                   /translation="MSTQDNPAVDNDNSLDDIFGSSPPQNTLNAPLPPTTATSQSTEPS
FT                   DLPGLRRQHVTAGYRDGTSASKGAHVQEGFDGGFPVGAQLGMRAGTVLGIMEGLLRGFE
FT                   ERNGPGVVKKPVRGQSAVSTGTDGATEIAELRRQKREQLRVLYEAALKELDVQAVFAEA
FT                   GGAPEIAPRAEDGEEERAEVQLGRKGDVVIAKWEGRVGVPGWEENMEALEMKEEGKGGG
FT                   QAVEHS"
     atgtcaactc aagacaaccc cgcagtcgac aacgacaatt ccctcgacga catcttcggc        60
     tcctccccac cccaaaatac ccttaacgca ccactcccac caacaaccgc aacctcccaa       120
     tcaaccgaac cctccgacct ccctggcctc cgccgccaac acgtgacagc aggctaccgc       180
     gacggcacat ccgcctccaa gggcgcacac gtgcaagaag gcttcgacgg aggcttcccc       240
     gtcggcgcac agctgggtat gcgcgctggt actgtactgg gcattatgga gggactgtta       300
     cgcgggtttg aggagcggaa tggaccgggt gttgtgaaga agccggtgcg gggtcaatct       360
     gctgtatcta cggggacgga cggtgctacc gaaattgcgg aattgcgtcg acagaagagg       420
     gagcagctgc gggtgctgta tgaagctgcg ttgaaggagc tggatgtaca ggctgttttt       480
     gctgaggctg gtggtgcgcc ggagattgcg ccgagggcgg aggatgggga ggaggaacgg       540
     gcggaggtgc agcttgggcg gaagggggat gttgttattg cgaagtggga ggggagggtt       600
     ggggttccgg ggtgggagga gaatatggag gctttggaga tgaaggagga gggcaagggc       660
     gggggtcagg ctgtggagca cagttga                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page