(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE21

PENCW_16.PE21        Location/Qualifiers
FT   CDS_pept        join(complement(61234..61695),complement(61071..61160))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187652" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671389"
FT                   /orf_name="Pc20g00210"
FT                   /product="Pc20g00210 protein"
FT                   /protein_id="CAP85350.1"
FT                   /db_xref="InterPro:IPR014807"
FT                   /db_xref="UniParc:UPI000183190D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF32"
FT                   /transl_table=1
FT                   /translation="MVFSRAFTRRAALARQSARPNIASRRTMIAAPGPNTGPLLERRAD
FT                   RELPNPNPGRKWLYTLPIFIIATGAGMLGIFNYQKSSSSIVNSTLYALRTSPRAREILG
FT                   DEIYFAQQIPWISGEMNQLHGRIDISFWVKGTKSQGKMKFRSIRPDRMSYFRTEEWSLE
FT                   TEDGTVVQLLDNDSDPFRKN"
     atggtcttct ctcgagcgtt cacgcggcgc gccgcgctcg cccggcaatc cgcccgaccc        60
     aacatagcca gccgacgcac aatgatagct gccccaggtc cgaacacagg accactactg       120
     gaacgacgag cggaccgcga gctaccgaac ccaaaccctg gccgaaagtg gctttacaca       180
     ctcccgatct tcattatcgc gacgggagca ggcatgcttg gaattttcaa ttaccagaag       240
     tcgtcgtcga gcattgtgaa cagcacgctg tatgcgctgc ggacgtcgcc gcgggctcgc       300
     gagatcctgg gcgatgagat ctacttcgcg cagcagattc cttggatcag tggcgagatg       360
     aaccaattgc atgggcggat tgatatctcg ttctgggtta aggggacgaa gtctcagggc       420
     aagatgaagt tccgaagcat tcggccggat cgtatgagct atttccgcac cgaggaatgg       480
     agtctggaga ccgaggatgg aacggtggtt caattgctcg acaatgatag cgatcccttc       540
     cggaagaact ga                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page