(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE210

PENCW_16.PE210       Location/Qualifiers
FT   CDS_pept        join(480371..481107,481142..481337)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217203" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947788"
FT                   /orf_name="Pc20g02100"
FT                   /product="Pc20g02100 protein"
FT                   /protein_id="CAP85539.1"
FT                   /db_xref="UniParc:UPI0001831672"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE84"
FT                   /transl_table=1
FT                   /translation="MSRLSLRLLGFTTAATGLAGYSIHRGLCHLEEKYPALPPAAGSEA
FT                   LRKAHSPNTQHCAYTDIYAAQIPLQVIEARVPNAKTPTQTELEYAWARSVTGSKILRVE
FT                   GSLLGLLTNFRFTPCDTGNSAEGFSPDKTTGAPRILLNGLLQVQRLPATDADSNGLLVS
FT                   MELPDAPRLFFEKIARWGYPWRLMSGVRHEMSVSEPFQRNGGIFVEVRFASAHDYEVVY
FT                   AEGELEKQKIIPAWVLRLHRGYASGKLRNNAANAGYMGYLHIPDLKLPGPSVCGGISQV
FT                   MEALAYSTLTLPSRYQAYIYLTILSIESN"
     atgtctagac tctccctccg actactaggg tttacaaccg ccgccaccgg cctagccggc        60
     tacagcatcc accgtggact ctgccatctg gaagaaaagt atccagcgct tcctcccgca       120
     gcggggagcg aagccctccg caaagcacac agcccaaata cccagcactg tgcatatacc       180
     gacatctacg cggcacagat acccctacaa gtcatcgaag cacgcgtccc aaacgcaaag       240
     acaccaacac aaacagagct cgaatacgcc tgggctagat ctgtcactgg aagcaaaatc       300
     ctacgagtcg agggctctct cctcggacta ctcacgaact tccgtttcac accatgcgac       360
     acaggcaact cagcggaggg gttttcaccg gacaagacca ctggtgcgcc gcgcattctg       420
     ctgaacggtt tattgcaagt gcagcgactt ccggccactg acgcagatag taacggacta       480
     ctggtctcga tggaactgcc ggacgcaccc cgcctgttct ttgaaaagat tgcgcgttgg       540
     gggtatcctt ggcgcttgat gtcgggtgtg cgacatgaga tgagtgtttc tgagccgttc       600
     cagagaaacg ggggtatatt tgttgaggtg cgattcgcaa gtgcgcatga ttatgaggtt       660
     gtttatgcag aaggtgagct ggagaaacag aagatcattc cagcttgggt tctgaggttg       720
     catcgtggat atgctagcgg gaagttgaga aataatgctg ctaatgcggg ctatatgggc       780
     tatttgcata ttccagacct gaagttaccg ggcccatcgg tttgcggcgg aatttctcag       840
     gtcatggaag ctctagcgta ctccacgctt acactcccct ctcgatatca agcatacata       900
     tacttgacaa tacttagtat cgagtctaat tag                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page