(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE211

PENCW_16.PE211       Location/Qualifiers
FT   CDS_pept        join(complement(481899..482000),complement(481481..481846))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000194771" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824368"
FT                   /orf_name="Pc20g02110"
FT                   /product="Putative uncharacterized protein Pc20g02110 "
FT                   /protein_id="CAP85540.1"
FT                   /db_xref="UniParc:UPI0001831673"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEA0"
FT                   /transl_table=1
FT                   /translation="MKFLAVCLMAIGLSRWTVNALPSPEDLAVLAYRAWDFRFLSEAPP
FT                   VCNSSVNNIEYSILHYSGAKRRDCQVLNLAKFNSTNVKSISWKSPSETNRYDLCMFSSP
FT                   DCSGGEDSLLGSINNGWDVCYLYNGFESWSIIPNGDACVPDGGDEEEGQGE"
     atgaaattcc tcgccgtgtg cttgatggcc attggcctct ctcgctggac tgtgaatgca        60
     ctacccagcc ctgaagacct cgcagtcctt gcctacagag cttgggattt ccgtttcctc       120
     agtgaagcac ccccggtttg caatagctcc gtgaacaata tcgaatactc cattctccac       180
     tactctggtg cgaaacggcg tgactgtcag gtattaaatc ttgccaaatt caactcaaca       240
     aatgtcaaga gtatctcatg gaagagccct tcggagacaa accggtatga tctttgcatg       300
     ttcagctctc ctgactgctc cggtggggag gacagtctgc tggggagcat taacaatggt       360
     tgggatgtgt gctatctgta caatggattt gagtcgtgga gtattattcc gaatggggat       420
     gcttgtgttc cagatggggg cgatgaggag gaaggtcagg gggaataa                    468
//

If you have problems or comments...

PBIL Back to PBIL home page