(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE218

PENCW_16.PE218       Location/Qualifiers
FT   CDS_pept        493817..495016
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194726" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947791"
FT                   /orf_name="Pc20g02180"
FT                   /product="Pc20g02180 protein"
FT                   /protein_id="CAP85547.1"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="UniParc:UPI0001831679"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEA6"
FT                   /transl_table=1
FT                   /translation="MSTPLLGEMSPAEAESVYFNEYPPPKALPRHEALARAFIDLHVEA
FT                   HRRVVLVTSGGTTVPLEAQTVRFIDNFSAGTRGATSAEYFLEQGYAVIFLHRQYSLLPY
FT                   SRHYSHSTNCFLDFMDEAPASADSSNPGHGPIMVRDEYQDQMRSVLRKYRYAKQNNRLL
FT                   LLPFTTVSEYMFELRSIAKLMRPLGPDALFYLAAAVSDFFIPRSRMAEHKIQSSELPPH
FT                   MRGSAISSDEIYTGENEEKASSNSRKLVINLDPVPKFLHQLVDGWAPEGSMVVSFKLET
FT                   DPSLLVYKARTALQRYSHHLVIGNLLSTRKWEVVFITPDEPHERWLRVPKSRRSKSISG
FT                   VEDQVGLAEAKKGNPSTSEEAKAEQVNETSRDGIEIESLIIPELVKLHTKMIEKTQAAQ
FT                   "
     atgtccaccc cattacttgg cgaaatgtcc ccagcggaag cagaatccgt ctatttcaat        60
     gaataccccc caccaaaggc actaccgcga catgaagcgc tggcacgcgc attcattgac       120
     cttcacgtcg aggcacaccg gcgtgtagtg ctcgtcacat ccggaggcac aacagtacca       180
     ctcgaagcgc aaaccgtacg attcatcgac aacttctccg ccggaactcg tggagccaca       240
     tcagccgagt acttcctcga gcaggggtac gcagtgatct tcctacaccg gcaatatagc       300
     ctcctaccat actcgcggca ttacagccac tcaacgaatt gcttcctcga tttcatggac       360
     gaggcgccgg cgtcggcgga ttcctccaac ccaggccatg ggcctattat ggtgcgcgac       420
     gagtaccaag accagatgcg cagcgtgctg cggaaatacc ggtacgcgaa gcagaacaac       480
     cgcctcctcc tgttgccgtt cacgacggtc tcagaataca tgttcgagct gcggtcaatt       540
     gcgaagctga tgcggccgct tggcccggat gcgctcttct accttgcagc tgctgtcagc       600
     gatttcttca tcccgcgcag tcgcatggca gagcacaaga tccagtctag tgagttgcct       660
     ccgcacatgc gggggagcgc aatctcttcg gatgagatct atacgggcga gaacgaagaa       720
     aaggcctcgt cgaatagcag gaagctcgtc atcaacctcg accccgtgcc caagtttctg       780
     catcagttgg tggatggctg ggctccggaa gggagtatgg ttgtctcatt taagctggag       840
     acggatccct cgctgcttgt ctacaaagcg cgcactgcgc tgcaacgcta ctcccaccat       900
     ctggtgattg gcaatttact ttcgacacgc aagtgggagg tagtcttcat tacgcctgat       960
     gagccgcatg agcgctggct ccgcgttccc aagtctcgac gcagcaagag tatctctggt      1020
     gttgaggatc aggttgggtt ggcggaggct aagaagggga atccatcgac gtcggaagaa      1080
     gcaaaggctg agcaggttaa tgaaaccagt cgggatggaa ttgagattga gagtcttatc      1140
     attcccgagt tggttaagct gcacacaaag atgatcgaga agacacaagc agcgcagtga      1200
//

If you have problems or comments...

PBIL Back to PBIL home page