(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE219

PENCW_16.PE219       Location/Qualifiers
FT   CDS_pept        join(495698..496702,496778..497107)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000194703" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977592"
FT                   /orf_name="Pc20g02190"
FT                   /product="Pc20g02190 protein"
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP85548.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="InterPro:IPR003378"
FT                   /db_xref="UniParc:UPI000183167A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEA7"
FT                   /transl_table=1
FT                   /translation="MVPRRLSRRLIAVAAAIALFFLYHVSSLSSHNRQWRPHFTTTEVT
FT                   PAVGDNGEPAPFCPPLPGIEDVLVVMKTGVTESRDKVPIHFQTTLRCIPHFVIYSDFAE
FT                   EIEGVKIHDVLRNMDSAAKKNPDFDFYHRIVKYGRKGLEQQDFSDEANSAIGKPNNPGW
FT                   KLDKWKFLPMAQEALRHKPDAKWFIFVEADTYVSWPTVLTWLARFDHTKPHYLGTETQI
FT                   ADVIFAHGGSGFMLSNPALQRASDEYAAREVELNAFTDQHWAGDCVLGKVLSDAGVNLH
FT                   FTWPILQNSNLGELDEFTTDFYRKPWCFIAVALHHLSPIDIENLWKFEQKRWRDKNKRI
FT                   LLHGDLFREYISPEINSQPTRPNWNNMANEDQPFAHTFEDCRLICQTQNACVQFAFREG
FT                   KCFTSANPRLGHAVPSGDATSGWITSRIRDMTGKKGLCRKPDFGD"
     atggtccccc gccggctcag tcgccgcctg attgcagtcg cagccgccat tgcgctcttc        60
     ttcctctacc acgtcagctc cttatccagt cacaatcgcc aatggcgccc tcacttcaca       120
     acgacagaag ttaccccggc cgtcggtgac aatggtgaac cagccccatt ctgcccaccc       180
     ttaccaggca tcgaagatgt gctcgtggta atgaagaccg gagtgacaga atcacgcgac       240
     aaagtcccca tccacttcca gacaacatta cgctgcatcc cccacttcgt gatatactcc       300
     gacttcgcag aagaaatcga aggcgtcaaa atccacgatg tcctccgcaa catggacagc       360
     gccgcaaaga agaacccgga cttcgacttc taccaccgta tcgtgaaata cggccgcaag       420
     ggtctagagc agcaagactt ctccgacgaa gccaactctg ccatcggaaa accgaacaat       480
     ccaggttgga aacttgacaa atggaagttc cttccaatgg cgcaggaagc gctccgccac       540
     aagccagacg caaagtggtt tatcttcgtt gaagcagaca cctacgtctc atggccgacg       600
     gtcctaacct ggctggcccg gtttgaccac acaaagccac actatctcgg cacggagact       660
     cagatcgcag acgttatctt cgcccacggt ggttcgggct tcatgctctc taaccccgct       720
     ctgcaacgcg cctctgacga gtacgccgcg cgcgaggtcg agctaaacgc atttacagac       780
     cagcactggg ccggcgactg cgtgctgggt aaggtcctca gcgacgcagg cgtcaaccta       840
     cactttacat ggccgattct tcagaattca aacctcggcg agctggacga attcaccaca       900
     gacttctacc gaaaaccatg gtgtttcatc gctgttgccc tccaccacct ctccccaatt       960
     gatatcgaga acctatggaa atttgaacaa aagcgctggc gtgataaaaa caaacgaatc      1020
     ctcttgcacg gcgacctctt ccgcgaatac atctcaccag agataaattc acagcccaca      1080
     cgcccgaact ggaataacat ggcaaacgaa gatcagccct tcgcgcacac cttcgaagac      1140
     tgccgcttga tctgccagac gcagaatgca tgcgtgcaat tcgccttccg cgaaggcaaa      1200
     tgcttcacga gtgccaaccc gcgtctcgga catgctgttc ccagcggcga tgcgacgtca      1260
     ggctggatta ctagtcggat tcgcgatatg acggggaaga agggattgtg tcggaaacct      1320
     gatttcggag attga                                                       1335
//

If you have problems or comments...

PBIL Back to PBIL home page