(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE22

PENCW_16.PE22        Location/Qualifiers
FT   CDS_pept        join(61865..62005,62062..62380,62432..62526)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234634" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946679"
FT                   /orf_name="Pc20g00220"
FT                   /product="Pc20g00220 protein"
FT                   /protein_id="CAP85351.1"
FT                   /db_xref="UniParc:UPI000183190E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF33"
FT                   /transl_table=1
FT                   /translation="MAAVRLRKAFRYPEESEGEREELDEEQQERVIEQLQSQNDARNAQ
FT                   YSMIFTALPVLAATVFVPSVLSASSQAERLFSLLGLASLLTTAYIMKCFPLHPDRKGKK
FT                   PMTFHTERIARLHAALVPGTSAVCLLLAVVYLSTEPSYAVHPVLYLIPGAMLAVILLAQ
FT                   KVMLSVDLASLKDLQYEYKGA"
     atggctgcgg tgagattgcg caaggcgttt cggtaccccg aggaatcgga gggcgaacga        60
     gaagagttgg acgaagagca acaggaacgg gtcatcgagc agttgcagag ccagaatgat       120
     gctcgcaacg cccagtacag tatgattttt actgcacttc cagtgctggc tgctacagta       180
     tttgtgcctt cggtgctgtc ggcctccagt caggctgaac gattgttctc gctcctcggt       240
     cttgcctcgt tgctgacaac ggcctatatc atgaaatgtt ttcctctcca cccagatcgt       300
     aaaggcaaga agcctatgac cttccacact gaacgtattg ctcggcttca tgccgctctg       360
     gtacctggaa ccagtgcagt ttgcttgtta cttgctgtgg tctacctttc tacagagcca       420
     tcttatgcgg tccatccagt tctatacttg attcctggcg ccatgctcgc agtaattcta       480
     cttgctcaaa aggtcatgct ctctgttgac cttgcatccc ttaaggatct acagtacgag       540
     tacaaaggtg cctag                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page