(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE221

PENCW_16.PE221       Location/Qualifiers
FT   CDS_pept        join(complement(502189..502559),complement(502069..502126),
FT                   complement(501882..502017),complement(501468..501828),
FT                   complement(501326..501405),complement(501078..501229),
FT                   complement(500812..501005),complement(500612..500760),
FT                   complement(499950..500527))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000268804" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947793"
FT                   /orf_name="Pc20g02210"
FT                   /product="Pc20g02210 protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAP85550.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI0001831751"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEA9"
FT                   /transl_table=1
FT                   /translation="MESYDDPEVASAADAPEVGDSAAAEAASAVGSDVGEPPVAGVLSG
FT                   VGPNAEAAHQIARDKGWTDPVPFEYAELANSKDHLEWAGVAARYEWKGEYGDIGPRVPE
FT                   LEEQLFSGDLIARAGAKLDALNGYKVKVESASEIESVTEWVNLGLHPVMLENVRLCGYE
FT                   HPTAVQSYAIPAVLANLDVIAVAQTGSGKTGAFLIPILSKLMGKARKLAAPRPNTAERF
FT                   NPREDAVRAEPLVLIVCPTRELATQIFDEARRLCYRSMLRPCVAYGGAPSRQQREELQK
FT                   GCDILIATPGRLLDFMAQTHVLSLRRVRYTVIDEADEMLESDWEEEFKKIMSGGDVNED
FT                   ADHRYMMFSATFNKEFRKLAKQYLNENHVRLRVGRAGSSHHNVVQDIIWADQPKKMRAL
FT                   YDLLISMPPVRTLIFVNSKEQVDFVDDYLFNSGMPTTSIHGGRTQREREDAMRAFRTAK
FT                   CPIMVATGVSARGLDVVNVLHVINYDLPSAIHGGITEYVHRIGRTARIGNEGIATSFYN
FT                   DRDEGIAEDLVKILIECDQAIPEFLQQYRPEGDVLEFDDDSDKEFFDNQSNAGAEAEAD
FT                   HESSNADAESAAAEAEADHESSNADAESAAAQAEAEESDKVVADDAEDDKPAVPRPTIT
FT                   SEEEEEASTWWGPTTIVTERKKPREEAKPKDTKAGLAGSHWAPKPKPAPKDDDAFWQ"
     atggagtctt atgacgaccc cgaagttgca tctgcagccg acgctcctga ggttggcgac        60
     tccgccgccg ccgaagctgc atctgctgtc ggttccgatg ttggagagcc tcctgttgca       120
     ggtgtgctct ctggtgttgg tcccaacgcc gaggctgctc accagattgc tcgggacaaa       180
     ggttggactg acccggttcc cttcgagtat gctgagcttg ctaatagcaa ggatcacctg       240
     gagtgggctg gagttgctgc ccgttacgaa tggaagggcg aatatggtga tattggccct       300
     cgcgtccctg aactggagga gcagcttttc agtggcgacc tgatcgctcg ggctggtgct       360
     aagctcgacg cgctgaacgg atacaaggtc aaagtcgaga gtgcaagcga gatcgagtcg       420
     gttaccgagt gggtaaacct tggcttgcat ccggtcatgc tggagaacgt tcgtctctgc       480
     gggtacgaac atcccaccgc ggtgcagtct tatgcgattc cggctgtgct agccaacctt       540
     gatgttattg ccgtggccca aactggctct ggaaagacgg gcgccttcct cattccaatt       600
     ctttccaagt tgatgggcaa ggcgaggaag ctggctgccc ctcggcctaa caccgcggaa       660
     agatttaacc caagggagga tgctgttcga gcagagccac tggtcctgat cgtctgtccc       720
     actcgtgaat tggccactca gatatttgat gaagcgcgtc gtctgtgcta tcgctccatg       780
     ctgcgtccgt gtgttgctta tggcggggcc ccttctcgcc aacagcgtga ggagcttcag       840
     aaaggatgcg atatcctgat tgccactcca ggccgtctcc ttgatttcat ggcacaaact       900
     cacgttcttt ctctccgtcg cgttaggtac accgtcattg acgaggcgga tgagatgctg       960
     gaatctgact gggaagaaga gttcaagaag atcatgtcag gaggagatgt gaacgaggat      1020
     gctgatcacc gctacatgat gttctccgct accttcaaca aggaattccg gaaacttgca      1080
     aagcaatacc ttaacgagaa ccatgtgcgc ctccgtgttg gccgagctgg cagttcacac      1140
     cacaatgttg tgcaggatat catctgggcc gaccagccga agaagatgcg cgcactctat      1200
     gaccttctga tcagcatgcc gcctgttcgc accttgattt tcgtcaacag caaggagcag      1260
     gttgacttcg tcgatgacta ccttttcaac tctggaatgc ccaccacctc aattcacggt      1320
     ggacggaccc aacgtgaacg cgaggatgct atgcgtgcct tccggactgc aaagtgtccc      1380
     atcatggttg ctaccggcgt ctccgctcgt gggcttgatg tggtcaatgt gctccatgtc      1440
     atcaactacg atctccccag cgctatacat gggggcatca ctgaatacgt tcaccgtatc      1500
     ggccgtactg ctcgcattgg caatgaaggc atcgccacct cattctacaa tgaccgcgat      1560
     gagggcattg ccgaggatct tgttaaaatc ttgatcgaat gcgaccaagc gatcccggag      1620
     ttccttcagc agtaccgccc tgagggtgat gtgctggagt ttgacgatga ctctgacaag      1680
     gaattcttcg ataaccagtc taacgctggc gctgaggctg aggctgatca tgaaagctcg      1740
     aacgctgatg ctgaatctgc tgccgctgaa gctgaggctg atcatgaaag ctcgaacgct      1800
     gatgctgaat ctgctgccgc tcaagctgag gctgaagaga gtgacaaggt ggttgcagac      1860
     gatgccgaag atgacaagcc tgctgttccc aggcccacta ttacatccga ggaggaggag      1920
     gaggcttcta catggtgggg gcctaccaca atcgtgactg aacgcaagaa gccgagggaa      1980
     gaagccaagc ccaaggatac caaggctggc ctggccggtt cccactgggc cccgaagcca      2040
     aagcccgctc ccaaggatga tgatgcattc tggcagtag                             2079
//

If you have problems or comments...

PBIL Back to PBIL home page