(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE223

PENCW_16.PE223       Location/Qualifiers
FT   CDS_pept        505713..507248
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671679"
FT                   /orf_name="Pc20g02230"
FT                   /product="Pc20g02230 protein"
FT                   /protein_id="CAP85552.1"
FT                   /db_xref="UniParc:UPI0001831753"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEB1"
FT                   /transl_table=1
FT                   /translation="MAESPLHVISDQLKRLAAQSPAARNASPVSAARVDATEPIIQGSV
FT                   LNAPEGTDSQVPTSTESDLTDIDESLLQDPSDPAPRPQSTPSETHFINPTAPRVSYQVS
FT                   ASGEVMIIEETQTPRPIARAPAPRPSPPAYLSFDRLAQGLSPKLASSPTTSTIQPPSLA
FT                   VERIIGPKQPIPARILELLEEWHEDSPYTEHPSALSGRAPTTWKHFKAFSDDGDECELS
FT                   IFQISLKGQTRRSVTYRIMILHSQNGPEELVVYGQPRPKFRGPLTKGTRGLYLLDWLEI
FT                   EQKGEVQACGLKLWRTDEQNITFSAHMFDYGRKCTRLSGPNDIFNMRASSSTPKKQSGA
FT                   NENIEDAGSNSSEPPYSPSRSSRQASTSNHPKPENEEDKTSVTPRPSPAKTGSPEFRPL
FT                   ASPWKPQKRRRGTWSSNDETSVLRYKLMSDESDQVRVFKTNDAKVLFEKAQQFYKGMEK
FT                   RTGLLCTVYGVEGVRYVGEGCVDEFDILQEDIRKTSGPGDEDRVVVVKPAMGF"
     atggccgaaa gcccactgca tgtgatttca gaccaactca aaagactcgc ggcgcaatca        60
     ccggccgctc ggaatgcatc ccccgtatca gctgcgaggg ttgacgctac tgagcctatc       120
     attcagggct ccgtcctcaa tgcaccggaa gggaccgact cacaagttcc gacttcaact       180
     gagtctgatc tgaccgatat cgacgagtca cttctacaag atccatcaga tcctgcccct       240
     aggccgcagt cgactccgag cgaaacccat ttcattaacc caacggctcc gcgtgtgagc       300
     taccaagtct ctgcatctgg cgaggtcatg attatcgaag aaacccaaac tcccagacca       360
     atcgctcgcg ccccagcgcc ccggccgagc ccccctgcat acctatcctt tgatcggctt       420
     gctcaaggct tgtcgccaaa gctggcatcc tcgcctacca cctcaacgat tcaacctccg       480
     tccctggcag tggagcgcat catcggccca aagcagccga tccccgcacg aatccttgaa       540
     cttctcgagg aatggcatga agattccccg tacacggaac atccctctgc tttgtctggc       600
     cgcgctccca ctacttggaa gcacttcaaa gctttcagtg atgacggcga cgagtgcgag       660
     ctatcgatct ttcagatctc actcaagggt caaactcgac gaagtgtgac ctatcgtatt       720
     atgatacttc actcccagaa cggccccgag gaacttgtcg tctacggcca acctcggccg       780
     aagttcagag gacccttgac caagggtacg agggggctgt acctactgga ctggctggaa       840
     atcgagcaaa agggcgaggt ccaggcttgc ggattgaagc tctggagaac agatgaacag       900
     aatattacgt tcagtgcaca catgttcgat tatggacgca agtgcactcg gctgtccggg       960
     ccgaatgata ttttcaacat gcgcgcctca tcttccacgc ccaagaaaca gtccggcgca      1020
     aacgagaaca ttgaggatgc tggatccaac tcatctgagc cgccttattc cccctcgagg      1080
     tctagccgcc aagcttcgac cagcaaccat cccaaaccgg aaaatgaaga agacaaaacc      1140
     tcagttaccc cacgcccgtc gccagccaag accggttcac ctgaattccg tcctctggcg      1200
     agtccctgga agcctcagaa gaggcgccgt ggcacatgga gctccaatga tgagacctct      1260
     gttcttcgct acaagctgat gtccgatgag tcggaccaag tccgtgtctt caagacgaat      1320
     gacgcaaagg tgttgtttga aaaggcccag cagttctaca agggcatgga gaagcgcaca      1380
     ggacttttgt gcactgttta tggtgttgag ggcgtccgat acgtggggga ggggtgcgtt      1440
     gacgaatttg atatccttca ggaggatatt cggaagactt ctggtcctgg tgatgaggac      1500
     cgcgttgtgg tggtgaagcc ggcaatgggc ttctaa                                1536
//

If you have problems or comments...

PBIL Back to PBIL home page