(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE224

PENCW_16.PE224       Location/Qualifiers
FT   CDS_pept        join(507964..508291,508369..508634,508968..509546)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194668" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947795"
FT                   /orf_name="Pc20g02240"
FT                   /product="Pc20g02240 protein"
FT                   /function="phosphatidylinositol N-
FT                   acetylglucosaminyltransferase activity"
FT                   /biological_process="GPI anchor biosynthetic process "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP85553.1"
FT                   /db_xref="GO:0006506"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0017176"
FT                   /db_xref="InterPro:IPR009450"
FT                   /db_xref="UniParc:UPI0001831754"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEB2"
FT                   /transl_table=1
FT                   /translation="MASPPSLDPFPPPIPVDTHPNRATGSKPPELERSLPDPNRLAPED
FT                   AYFAPSLSRARSAPSNYEENLRSLNGDGSAHIGSTAALRKKLGGPGRRRKRKGAWKKLL
FT                   WVKQSYPDNYTDTETFLDHLQRNPRVRPYDFWPLVADSTVIVQHVCSVVIFVCCFVGIV
FT                   QDRVSPVSIVCWGSVGTAVGWILWDNWIWKEHGESRLTTVKSAFLIYFSLLGLSPILKS
FT                   LTKSTASDSIWAMSCWLLIMNIFSFDYGSGEGAGATTKFPASLSTNAAVMASTVLASRL
FT                   PSTTHVFSLMLFSMEVFGLFPIFRRQLRQKSWTGHVLLTLALVIVAGGAVGVTLSGGWA
FT                   AAIIGSVLGSILTAFVMGGCSWWLISLQKYKNVVIGPWDPARPIIRRHWN"
     atggcgtctc ctccctcgct agaccctttc cctcctccga tccccgtcga cactcatcca        60
     aaccgcgcta cagggtccaa gcctcctgag ctcgaacgat ccctccccga ccccaatcga       120
     ctggcccccg aagatgcgta cttcgcaccc tcactttcgc gcgcccggtc agcgcccagt       180
     aactacgagg aaaatctgcg gtcgttgaac ggtgacggca gtgcccatat tgggtctact       240
     gcggcgctgc ggaagaagtt gggcggtcct ggacggcgac ggaagcgaaa gggagcctgg       300
     aagaagttgc tttgggttaa gcaatcgtat ccggataact acaccgacac ggaaacgttt       360
     cttgaccacc ttcagcgtaa tcctcgggtg cggccgtatg atttctggcc tctggtggct       420
     gactcgactg tgattgtgca gcatgtctgt tcggtggtta tctttgtttg ctgcttcgtc       480
     ggcattgtcc aagaccgggt gagccctgtc tcaattgtct gctgggggag cgttggcacg       540
     gcagtgggct ggattctatg ggataattgg atctggaagg agcatgggga atcccgcttg       600
     actacagtca agtcggcctt ccttatttac ttctccctcc tgggcctcag tcccatcttg       660
     aaatctctta ccaagtccac cgccagtgac tcgatctggg cgatgagctg ctggctttta       720
     atcatgaata tattctcttt cgactatggg agcggggaag gcgcaggcgc cactaccaag       780
     tttcctgctt ctttgtccac caacgcagct gtgatggcat cgaccgtgct cgcgtcccgg       840
     ctgccctcta cgacacatgt gttcagtctc atgttgttct ccatggaggt atttgggctg       900
     ttccccatct tccggcgcca actgagacag aaatcatgga ctggtcatgt gcttctgaca       960
     ctggcccttg tgatcgttgc tggtggcgct gttggtgtca cgctgagcgg cggttgggca      1020
     gcagccatca ttggatccgt cctaggaagt atcctgactg cgtttgtcat gggcgggtgc      1080
     agctggtggc ttatcagctt gcaaaagtac aagaacgttg tgatcggtcc ctgggaccct      1140
     gcccggccga tcattcggcg ccactggaac taa                                   1173
//

If you have problems or comments...

PBIL Back to PBIL home page