(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE226

PENCW_16.PE226       Location/Qualifiers
FT   CDS_pept        join(complement(515148..515444),complement(512152..515097))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216236" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977593"
FT                   /orf_name="Pc20g02260"
FT                   /product="Pc20g02260 protein"
FT                   /function="acyl carrier activity"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP85555.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI0001831756"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEB4"
FT                   /transl_table=1
FT                   /translation="MATVTITTTEGGVKPLQTQDIATRLLNGTLHSQWPPFEQFATIDG
FT                   LLKSHAAQPDEAKRPLICYPIRGAADFEEHTAGAIDRYTDLAVRFYMQQGLVPADPNLE
FT                   QAPVVAMLAGSSFEVVVTFFALNRLGYAVLFLSTRLTAPAYIRLMEMANCSQLIKANQF
FT                   QQVVTEICAERPGCSTFSLLQREDWFNRPVSTPLFERPGADPSGEGKKIAWILHSSGST
FT                   GFPKPIFLTNLQTLANFCKSFGLRLFTISPLFHSHALMEFGRAFYTRAPAYLGNHSLPV
FT                   TYQNLFDALQVAKPQQISAVPYVIKLLAEKQEGIQALARPQLVLYGGSSCPDDLGDRLV
FT                   AQGVNLVGNYGATETGQIMTSFRAPEDKEWQYMRLHRPVADLTLMDEISPGVFECVALD
FT                   GLPSKGPSNSKPPYSAKNPENSFRTADLFTRHPDPEKDNYYKYLSRLDDRITLVNGEKV
FT                   LPIPIEGRVREEPIVSDCVVFGFQRTVPGALIFRAPGKVPHLSDAEFLEAIWPAVEAAN
FT                   SRAETFSRIPKELVVIEGSDVVYARTDKGTCIRAQVYQQFEEDIKQAYAKFEGSGQKRG
FT                   SLALSIPQLEDWLLSRFSEDLGVLIPGAEADIFSAGVDSLQTTQIWRCIMRDIDIGEGG
FT                   DQLSQNIVFEKGTVSALARHLYQLRTGQEFEREDELHSMREMIEKYSHFTHHFPTIARS
FT                   PETEVVMVTGATGNLGAFIVSELLKRPTVSEVWAIVRAPGQAAAGARLYKALADRSIVL
FT                   TEPEAAKLHAVPGDMSQPNLGLKDHDLQHLVSCLTCIIHSAWAVNFNLGVRSFEQQHIR
FT                   GTYNLINLCLRSHLPSPARFFFCSSVSAAGNTPKPASIPETIIEDLEHAQRTGYGRSKL
FT                   VTEHITRNAMRQTGMQARVLRIGQLGGDTVGAQWNDTEAVALMFRSALTTGALPELNER
FT                   PSWLPVDQCGRAISDIAMNVSGSADLNMVYHLVNPRTFSWKDDLLPALRQGSALAEFEV
FT                   VPPQEWLSRLATSEQDPEKNPSVKLIDFWRSKYASHGLSETGPGRNEEAGLTFETERTV
FT                   QDCPSLGLVEDPVASGLIQRYIESWMSRWAGE"
     atggctacag taaccatcac gactactgaa gggggcgtca agccacttca gactcaagat        60
     attgcgactc gcctcttgaa cggcacgctt cattcccagt ggccgccatt cgaacagttc       120
     gcaaccatcg atggcctatt gaaatctcat gcagcccaac cagatgaggc aaaacgacct       180
     ctgatatgct acccaattcg cggagcagct gattttgagg aacatacagc gggggccatc       240
     gatcggtata ctgatctcgc tgttcgcttt tacatgcagc aaggactcgt acccgcggac       300
     ccaaatctcg agcaggcacc tgttgtcgct atgctagctg gatctagttt cgaggtcgtg       360
     gtgactttct tcgcgctgaa tcgccttggc tatgccgtgc ttttcttgtc cacacgcctc       420
     acggcaccgg cttatattcg gctaatggag atggcaaact gcagccagct cattaaagca       480
     aaccagtttc agcaagttgt aactgaaatt tgtgccgagc gtcctggctg tagtaccttt       540
     tctctactgc aaagagagga ctggttcaac cgtccggtta gcactcctct ctttgaacga       600
     ccgggtgcag atccatcagg agaaggcaag aaaattgcct ggattctaca ttcatcgggg       660
     agcaccggtt tcccgaagcc gattttcctt accaaccttc aaacgctagc caatttctgc       720
     aagagcttcg gcctacggct cttcactatt agcccgctct tccactcgca cgctctaatg       780
     gagtttggaa gagcatttta tacaagagca ccagcgtacc taggaaacca ttctcttccg       840
     gtcacatacc agaatctttt cgatgccctc caggtggcga agccacaaca aatcagcgcc       900
     gtgccatacg tgatcaaact gttggcagag aagcaagaag gcattcaagc actggctcgc       960
     ccgcagctcg tgctatacgg cggttctagt tgtccagatg atcttggcga ccgtcttgtt      1020
     gcacagggcg tgaatctggt cggcaactat ggagcgacgg aaacgggaca aattatgact      1080
     tctttccgag ctccggaaga taaggagtgg cagtatatgc gactgcaccg tcctgttgcc      1140
     gacctcacct tgatggatga aatctcgccc ggggtttttg aatgcgttgc gttagacggc      1200
     ctgccgagca agggtccttc caattcaaaa ccaccgtata gcgcaaagaa cccagagaac      1260
     tctttcagaa cagccgattt gttcaccagg cacccggatc cagagaaaga caattattat      1320
     aaatatttga gtcggcttga cgatcggatc accctagtca atggcgaaaa ggtgcttcct      1380
     attcctattg aaggccgcgt cagggaagag cctatcgtga gtgactgcgt tgtgttcggc      1440
     ttccagcgga ctgtgcctgg ggctttgatt ttccgtgctc ctggcaaggt gcctcatctc      1500
     agcgacgctg aatttttgga agctatctgg ccagctgttg aggcggcaaa ttctcgcgcc      1560
     gagacgttct cccgtatccc caaggagctt gtcgtgatcg aaggttccga tgttgtatac      1620
     gccagaactg ataaaggaac ctgtatacgc gctcaggttt atcagcaatt tgaagaggat      1680
     atcaagcagg catatgccaa atttgaaggg agtggccaga agagaggttc cctcgcgctc      1740
     agcattccac aactggagga ttggttgctt tcaagattca gcgaagactt gggcgtactg      1800
     atacccggtg ctgaggccga tatcttctcg gctggagtcg acagtttgca gacaacgcaa      1860
     atttggagat gcattatgcg cgatatcgat atcggcgagg gaggagacca gctttcacag      1920
     aacattgtgt tcgagaaagg cacagtcagc gcactggcga ggcacctcta ccagctgcga      1980
     actggtcagg aattcgagag agaagatgag cttcattcca tgcgtgaaat gatcgagaaa      2040
     tactcccatt tcacccatca tttcccaacg atagcccgaa gcccagaaac agaggtggta      2100
     atggtcaccg gcgcaaccgg caatttgggg gctttcattg tctccgaatt actgaaacga      2160
     ccaacagtct ccgaagtatg ggcaatcgtg cgcgcaccag gtcaagcagc ggcaggagcc      2220
     cgtctctaca aagcactggc tgatcgcagc atcgttctca ccgaacccga agcagcgaag      2280
     cttcacgccg tccctggtga catgtcacag cccaacctcg gtctcaaaga ccacgatctg      2340
     caacacttag tctcatgctt gacatgcatc atccacagtg cctgggctgt caacttcaac      2400
     ctgggcgtgc ggtccttcga gcagcagcat attcgcggaa catacaacct catcaacctc      2460
     tgcctgcgct ctcatctacc ctcccctgca cgcttcttct tctgctccag tgtaagcgct      2520
     gcgggcaata cccccaaacc cgcgtcaatt cccgagacca taatcgagga tttggagcac      2580
     gcacaaagga ctgggtacgg caggtcgaag ctggtcacag agcacatcac tcgtaacgcc      2640
     atgcgtcaga cgggcatgca agcccgagtt ctgagaatcg gtcagcttgg cggcgatacg      2700
     gtcggcgcac aatggaacga cacggaagcc gttgcgctta tgttccggag tgcgttgacg      2760
     acgggtgcat tgccggaact gaatgagcgg ccgagttggt tgcctgttga tcagtgcggt      2820
     cgggctattt cggacattgc catgaatgtg tccgggtctg ccgatcttaa catggtgtac      2880
     cacttggtta atcctcgcac ttttagctgg aaggatgatt tgcttcctgc tctgagacaa      2940
     ggttcagcct tggcggagtt tgaggttgtc cctccgcagg agtggctgag caggttggcg      3000
     actagtgagc aggacccgga gaaaaatccg agtgtgaagc tcatcgattt ctggagatct      3060
     aagtacgcaa gtcatggtct gtcggagaca gggccaggga ggaatgaaga ggctggtctc      3120
     acatttgaaa ctgagcggac agtgcaggac tgcccctctc tcggtcttgt ggaagatcct      3180
     gttgccagtg gattgatcca gaggtatatt gagtcatgga tgagtcggtg ggctggtgaa      3240
     taa                                                                    3243
//

If you have problems or comments...

PBIL Back to PBIL home page