(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE23

PENCW_16.PE23        Location/Qualifiers
FT   CDS_pept        join(complement(64947..65214),complement(62861..64872))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187630" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977330"
FT                   /orf_name="Pc20g00230"
FT                   /product="Pc20g00230 protein"
FT                   /protein_id="CAP85352.1"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR013129"
FT                   /db_xref="UniParc:UPI000183190F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF34"
FT                   /transl_table=1
FT                   /translation="MPAHRTRLAFEPLSPLLDIHRVVESTPNFEFAMDITCDAIEDFPL
FT                   EDFEKLVLYQVVLSGRPLVIRGFHQRLDKRIFSEKWLRAKYAKKVEEVRDLVKKKTFNF
FT                   SMGHYLDNLSLLTRQVTVHNYTHKDLQRLYLKDIDCPPEWHAYLENLLPPFLFYLNEGP
FT                   KGFEGSASGKTNLSEIPKSTQGDPIAPSGDLMSSLPPSMRAENLMCYIGHEGTYTPAHQ
FT                   EMCASLGHNIMVEASDGSVENGKPTVPGSSIWLMTETKDRRIVSEYWMSVLGHDIDIED
FT                   FFAPLHAWEIAPFKTWVVEQRPGDLILVPPLAAHQVWNRGTRTTKVAWNRTTVDTLELA
FT                   LHEALPHARMVCRDEQYKNKAIVYFALERYSKLLRQAKKVDHPVVVQLWDDFKRLFNLY
FT                   KGILLSESFSQKNPEKNVEYHEFQSNVTCSFCRCNIFNRFLTCPGCANALGGEEDPYDI
FT                   CMDCYVMGRSCACISHLKWMEQFPWKLLTERYETWRRLIISSDENNKDLKVQFPTFIVA
FT                   RGQVGKKSVAEICQEQLVRRPWNDPKKPKPVVDNTNEDAGSESEGNSRSKKRRKMRQSL
FT                   MAKSDDVHRCHVCLHFEVNWKLAPCSNCDQRYCYGSLFRAFEISPQEAMEKHHWLCPKC
FT                   RKECSCGACQRDPSMKPYEPNCTILGHDTSKVADPRSIETLVDFRKSNLWWLKKFGDDV
FT                   HGRIQKRQKEAEEAELERQKTLEDQGFSFETSPFDPPQNGNGNDENPLGFDDNDGGIPV
FT                   DPSLMT"
     atgccagcac atagaacccg gctggctttt gagccactct cgcctcttct ggacatccat        60
     cgggttgtcg agtctactcc gaatttcgag tttgcgatgg atatcacctg tgacgcaatt       120
     gaggatttcc ctcttgagga tttcgagaag cttgtcctgt accaggttgt cctgagcgga       180
     agacccttgg taatcagagg atttcatcaa cgtcttgaca aacgtatttt ttcggagaaa       240
     tggctccgag caaaatacgc gaagaaagtg gaggaagtta gagatctagt aaaaaaaaag       300
     accttcaatt tcagtatggg tcactacctt gacaatctgt cacttctcac tcggcaagtg       360
     acggtccaca actacacaca caaggacctc caacggctct accttaagga catcgactgt       420
     ccacccgagt ggcatgctta tctagagaac ctgttaccac cgttcctttt ctatctaaac       480
     gaagggccca aaggcttcga aggctctgcg tcgggaaaga caaatctgtc tgaaattccc       540
     aagtccaccc aaggcgaccc catcgcgccg tcgggtgatt tgatgagcag tcttccccca       600
     agcatgcgcg cggagaacct gatgtgctac atcggccatg agggtacgta cacaccagca       660
     caccaagaga tgtgtgctag tctcggtcac aacataatgg tcgaggcgtc cgatgggtct       720
     gtagaaaacg gcaagccaac ggtacctggt tcttcaattt ggctcatgac agagaccaaa       780
     gatcgacgga ttgtttccga atactggatg tctgtccttg ggcatgatat tgacatcgag       840
     gatttctttg cccccttgca tgcatgggag attgcaccat tcaagacctg ggtggttgaa       900
     cagaggcccg gcgaccttat tcttgtaccc cctcttgctg cacaccaggt ttggaaccgc       960
     ggcactcgga cgacgaaagt tgcctggaac cgcactactg tggacacgct cgagctggct      1020
     ctgcatgaag ctttgccgca tgcgcgaatg gtctgccgtg atgaacaata taagaacaaa      1080
     gccattgttt actttgctct tgagcggtat tcaaaattgt tgcggcaagc aaaaaaggtc      1140
     gaccatcctg tggtggttca actgtgggac gatttcaaac gtctttttaa cctgtacaag      1200
     ggcattttgc tgtctgaatc attttctcag aagaacccag agaagaacgt cgaatatcat      1260
     gagttccaaa gcaacgtcac ctgctcattt tgccggtgca acatctttaa caggtttctt      1320
     acctgtcctg gctgcgcaaa tgcccttggg ggcgaggagg acccatacga tatatgcatg      1380
     gattgctatg tcatgggtag aagctgtgcc tgcatttccc atctcaagtg gatggaacag      1440
     tttccgtgga agctgttaac agaacgatac gaaacatggc gacggctgat catttcctcc      1500
     gatgagaaca acaaggattt gaaggttcag tttcccacct tcattgtcgc tagaggacag      1560
     gtaggcaaaa agtctgtggc cgagatttgc caggaacaac tggtgcgccg cccctggaac      1620
     gacccaaaga agcccaagcc cgtggtagac aataccaacg aagatgctgg tagtgagtct      1680
     gaaggaaaca gccggtcaaa aaagcgccgc aaaatgcggc aatcacttat ggcgaaatct      1740
     gatgatgtcc accgctgtca cgtttgtctt cattttgaag tcaactggaa actcgctcca      1800
     tgctcgaact gtgaccagcg ctactgttac ggcagtttgt tccgcgcctt tgaaatctcc      1860
     ccacaggagg cgatggaaaa acatcactgg ctctgtccaa agtgtcgtaa agaatgcagt      1920
     tgtggtgcct gccagcgtga cccttcaatg aaaccatatg agcctaactg taccattctg      1980
     ggccatgata ccagtaaggt tgccgatccc cgcagcatcg agaccctggt tgatttccgg      2040
     aaatcaaatc tgtggtggct gaagaagttt ggcgatgatg tccacggacg tatacagaaa      2100
     cgccaaaagg aagccgagga agctgaattg gagcggcaga agacccttga agatcagggg      2160
     ttcagcttcg agaccagccc cttcgacccg ccacagaatg ggaacgggaa tgatgagaac      2220
     ccacttggct tcgacgataa cgacgggggg atccccgtgg atccctcgtt gatgacctag      2280
//

If you have problems or comments...

PBIL Back to PBIL home page