(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE233

PENCW_16.PE233       Location/Qualifiers
FT   CDS_pept        join(529691..529880,529948..530165,530227..531501)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000135353" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671680"
FT                   /orf_name="Pc20g02330"
FT                   /product="Pc20g02330 protein"
FT                   /function="sulfuric ester hydrolase activity"
FT                   /protein_id="CAP85562.1"
FT                   /db_xref="GO:0008484"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniParc:UPI0001831759"
FT                   /db_xref="UniProtKB/TrEMBL:B6HED5"
FT                   /transl_table=1
FT                   /translation="MTRPNFLVIVADDLGFSDTGAFGGEIKTPNIDNLANGRLRFTDFH
FT                   AASACSPTRAMLLSGTDNHIAGIGTMSETWTGDQKGKPGYEGYLNDRVAPFPELLQAAG
FT                   YHTLMSGKWHLGLTPERWPCRRGFDRSFSLLPGAANHYAWEPQLEESNNAPGLLGETNV
FT                   FYVENDKHIQPQELGDDFYSSDAFATKLIRYLDERDAAEKEKPFFAYLAFSAPHWPLQA
FT                   PDSDIQDYRGVYDEGPEALRQRRLKRLKELGLIPEHTVPHDVVAVGGHDLSRDWGELDA
FT                   EKQAFSARTMECYSGMVQNMDRHIGRVVEYLREQGELENTFILFMSDNGAEGLLLEAIP
FT                   IIKGDVHDHIAQYYDNSLQNMGRKNSYVWYGPHWASAATAPGRLYKSFTTEGGIRVPFI
FT                   LNYPPLTARSYPGGIDHSFATVMDIAPTILELAGVDHPGTTYRGRTVAPIRGKSWVPYL
FT                   TGQTGSIHSDNAVMAWELFGRQAIRKGRYKAVYIPKPYGPERWQLYDLVQDPGERDDLT
FT                   DHLPDTFADLIKEWDRYVYDVGLVQGSAQPSYVVEEKGYCYED"
     atgacccgac caaacttcct tgtcattgtc gccgacgatc tcggcttctc cgacactgga        60
     gcgtttggtg gagagatcaa gactcccaac attgataacc tagccaacgg tcgcctccgc       120
     tttaccgatt tccacgcagc atcagcatgt tcgccgacga gggcgatgtt attaagcgga       180
     accgacaatc atattgcagg catagggaca atgtccgaaa cgtggaccgg ggaccaaaag       240
     ggcaaaccgg gctatgaggg ctatctaaac gatcgcgtag caccatttcc cgagctactt       300
     caagctgctg gctatcacac gctgatgtca gggaaatggc acctagggct gactcctgag       360
     cgctggccat gccgaagagg ctttgaccgg tcgttttcgc tcctccctgg tgctgcaaat       420
     cactacgcgt gggaacccca gttagaagag agcaacaacg ccccaggtct tcttggtgag       480
     accaatgtct tctacgtaga aaatgacaag cacatccaac cccaagagct gggagatgat       540
     ttctactcat ccgacgcgtt tgcaacgaaa ctaatccgat acctggacga gcgagacgca       600
     gctgaaaagg agaagccatt cttcgcctac cttgccttct cggcgcccca ctggcccttg       660
     caggccccgg acagtgatat tcaggactac cgcggcgtgt acgacgaagg gccagaagcg       720
     ctgcgacagc gccgcctgaa gcgcctcaag gagctcggtt taattcccga gcacacagtc       780
     ccccacgacg tcgtcgctgt cggcggacac gacctctccc gggactgggg ggaactcgac       840
     gcggagaagc aggcgttctc cgcccgcaca atggagtgct attcaggcat ggtccagaac       900
     atggaccggc acatcggccg tgtcgtggag tatctccgcg agcagggcga gctggagaat       960
     acgtttatcc tctttatgtc tgacaacggc gccgagggtc tcttgctcga ggctattccg      1020
     attatcaagg gcgatgtcca tgaccatatc gcgcagtact acgacaactc cctgcagaac      1080
     atgggcagga aaaattcgta tgtctggtat gggccgcact gggcgtcggc ggctacagca      1140
     ccagggcgtc tgtacaaatc cttcaccact gaggggggca tccgcgtccc gttcattctg      1200
     aattatcctc ccctaacggc tcgtagctat ccgggtggta ttgaccactc gtttgcaacg      1260
     gtaatggata ttgctccgac tatactcgag ctcgcagggg ttgaccatcc gggaacaacc      1320
     taccgtggcc gcaccgtggc ccctatccgt ggtaaatcct gggttcccta cctgacggga      1380
     cagacgggaa gcatccactc ggataatgcc gtcatggcct gggaactctt cggtcgacag      1440
     gctatccgga aagggcgata caaagcggtg tacatcccca aaccgtatgg ccctgagagg      1500
     tggcaactgt acgacttggt ccaggacccc ggcgaacgtg atgacttaac ggaccacctg      1560
     ccagacactt ttgcagactt gataaaggag tgggatcggt atgtctatga tgttggactg      1620
     gtgcaaggct cggcacaacc atcttatgta gtggaggaga aaggttattg ctatgaagat      1680
     tag                                                                    1683
//

If you have problems or comments...

PBIL Back to PBIL home page