(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE234

PENCW_16.PE234       Location/Qualifiers
FT   CDS_pept        complement(531801..532268)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000267215" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977594"
FT                   /orf_name="Pc20g02340"
FT                   /product="Pc20g02340 protein"
FT                   /protein_id="CAP85563.1"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="UniParc:UPI000183175A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HED6"
FT                   /transl_table=1
FT                   /translation="MSSTIPYFRPSNHAQGLANYPHARTVPSSNGQGSYIYVSGTSSRR
FT                   GDGTFVGATRTEDSAGKVTLDLDIRQQTASVLSNIHADIQAASKGKAGIHDVVDATVFL
FT                   TSINGDYSGMNEEWNRVWPDRTTAPARTTVEVRALPREEILVEIKCVAYYQ"
     atgtcgtcca caatcccata cttccgaccc tcaaaccacg cccaaggctt ggccaattat        60
     ccccatgcac ggactgtgcc atcgagcaac ggccaaggat catatatata cgtgtcggga       120
     acatcttcgc gccgtggcga tggaacattc gtcggcgcca ctcgcacaga ggattccgca       180
     ggcaaggtca cgctagacct agacatccga cagcaaaccg catccgtcct ttccaacata       240
     cacgcagaca ttcaagcggc ctcgaaaggg aaggcaggga ttcacgacgt cgtcgacgcg       300
     acggtcttct tgaccagcat aaacggcgac tattcgggca tgaacgagga gtggaaccgt       360
     gtgtggccgg atcgcactac agcaccagcc cggacaacgg ttgaagtgcg cgcattgcca       420
     cgcgaagaga tactggtgga aatcaaatgt gttgcgtatt accaataa                    468
//

If you have problems or comments...

PBIL Back to PBIL home page