(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE235

PENCW_16.PE235       Location/Qualifiers
FT   CDS_pept        join(complement(534379..534788),complement(534057..534295),
FT                   complement(533127..534001))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000271505" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947797"
FT                   /orf_name="Pc20g02350"
FT                   /product="Pc20g02350 protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP85564.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI000183175B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HED7"
FT                   /transl_table=1
FT                   /translation="MDAVSTLWELDTLESANDYLASHGSNAPRLQHFIDGSFGRHSEPV
FT                   EWIESLNPRSGRLLAQIPSGTVTDVDRAVDAASIAFLTWSKTSRQERSQVLMRISDILG
FT                   EKKELFAVWESIDQGKTLARARVEVERAISNFRLFSLRYFATYILHEEGAVRYVDGQPF
FT                   TLTYEHRSPVGVFGLISPWNMPLYLLTWKIAPCLAFGCTGVAKPSEVTSITAFLLGEVF
FT                   RQAKLPAGVMNLVFGDGPGTGSALVKSSRVRGVSFTGGTNTGIRIRQDTVADIGKHLSL
FT                   ELGGKNPVLVFDDVDLTKAVPLAARAAFENSGQVCLCGSRIYVQRAVYAKFLSALVEYV
FT                   ESNYKLGETMGPVVSREHYLKIRGYLVQAQEENAVFHTGDVPDEEPQQGFWITPTVLTN
FT                   LPTGSRVMREEIFGPVVTVCPFGTEEEAIALANDNPNGLAGIVMTNNLARMRRVGERID
FT                   AGLIWVNCWLVRELGTGFGGMKASGTGREGGAHSRDVFTNLRTLHVSHF"
     atggatgctg tctccacgct atgggagctc gacacattgg agagcgcaaa tgactacctg        60
     gcaagccatg gatccaatgc cccccgccta caacacttta tcgatggctc cttcggtaga       120
     cattcagaac cagttgaatg gattgagtca ttaaatcctc gttccggcag gctcctggcg       180
     caaatcccca gcggcacggt gactgatgtg gaccgcgctg tggatgctgc ttcgatagcg       240
     ttcctgacat ggtcaaagac gtcgcgacag gagaggtcac aagtgctgat gcggatttcc       300
     gatatcctgg gtgagaagaa agaacttttt gcagtctggg agagcattga tcaggggaag       360
     acactggctc gggccagggt cgaggtagag cgtgcaattt cgaactttcg attgttctct       420
     ctcagatact ttgctacata tatcctgcac gaagagggcg cagtgcgata tgttgatggg       480
     caaccattca ccttgacata tgaacatcga tcgcccgttg gggtatttgg gctcatctca       540
     ccgtggaaca tgccactgta tctcctgacg tggaagatcg ctccttgtct cgcatttgga       600
     tgcacaggtg tggcaaaacc aagtgaagtc accagcataa cagcgttttt gctaggtgaa       660
     gtcttccggc aagcgaagct accagcgggc gtgatgaacc ttgttttcgg cgatggccca       720
     ggcactggct cagcgctcgt gaagtcgtcg cgcgtgcgag gagtgtcgtt caccggcggc       780
     acgaacacag gcatccgcat tcgacaggac acagtggctg acattgggaa gcatctgtcg       840
     cttgagcttg gtgggaaaaa tccagtctta gtgtttgacg atgtcgacct aaccaaggct       900
     gttcctctcg ctgctcgggc ggcgtttgag aatagcgggc aagtctgcct gtgcggctca       960
     cgtatctacg tccagcgcgc agtgtacgcg aaatttctgt ctgcactggt tgaatacgtt      1020
     gaaagcaatt acaagctcgg ggagacgatg ggtccggttg tctcgcggga gcactacctg      1080
     aagattcgcg gctatctggt gcaggctcag gaagagaacg ctgtcttcca tacgggagat      1140
     gtgccggatg aagagcctca gcagggtttc tggatcacgc cgacggtcct tactaacctt      1200
     ccgaccggca gtcgagtcat gcgcgaggag atctttggac ccgtcgtcac tgtgtgtccc      1260
     ttcggcacag aagaagaggc catcgcattg gcaaacgaca accctaacgg gctggccggt      1320
     attgtcatga ccaataacct ggcccgaatg cgtcgggtgg gcgagcgtat cgatgccgga      1380
     ttgatttggg tcaattgctg gctagttcga gagctcggaa caggatttgg gggcatgaag      1440
     gcgtctggca ccggccgtga aggtggagcg cacagccgtg atgtctttac caatctgcgt      1500
     acccttcatg tgtcgcactt ctag                                             1524
//

If you have problems or comments...

PBIL Back to PBIL home page