(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE236

PENCW_16.PE236       Location/Qualifiers
FT   CDS_pept        join(complement(535674..536296),complement(535150..535612))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000254105" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947798"
FT                   /orf_name="Pc20g02360"
FT                   /product="Pc20g02360 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP85565.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR006992"
FT                   /db_xref="UniParc:UPI000183175C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HED8"
FT                   /transl_table=1
FT                   /translation="MPPYLPDFSTSHCMSQSNSQEWITLRPHDTPGGISDGQNSPTASK
FT                   VDMFVGDRFFRTVEPNCFDPYVRIAEMDASGVDVQVISTVPVLFSYDKPVEPAAAMARY
FT                   LNDHIASVCRDHPRRFVGLATVPLQDVAVSIKELRRAKDILGLKGVEIGTEVSGKTLNS
FT                   ADFEPFWTACEELDFPIFVHPLGYELEQENKERWGKYWSAWLIGMPSETALAMHSILSS
FT                   GVLVRHPNLRFCFAHAGGAYLPLLGRIQHGYDCRPDLVAHSSQGVLPQDYIQSQQHNIW
FT                   LDSLVHDPDLLQFICKKIGAERIIMGSDYPFPLGEMPVPGEMLASDAQVGSFLSQEKRA
FT                   QMLSGNAIEFLGLEGMFPGCK"
     atgccgccat atttgcctga tttctctacc tctcattgca tgtcgcagtc aaacagccaa        60
     gaatggatta cccttcggcc gcatgatacg ccgggcggca tatccgacgg ccagaacagc       120
     ccaaccgcca gcaaggtcga tatgtttgtc ggcgacagat ttttccgtac ggttgagccc       180
     aactgctttg acccatacgt ccgcatcgca gaaatggatg cttcgggtgt ggatgtgcag       240
     gtaattagca cggtgcccgt gctgttctca tacgacaagc ccgtcgagcc agctgcggcg       300
     atggcccgat acctaaatga ccacatcgcg tccgtgtgtc gcgatcatcc tcgtcgattt       360
     gtgggcttgg caactgtgcc tttgcaggat gtggctgtgt caatcaagga gctgaggcgc       420
     gcaaaggaca tcttgggact gaaaggtgtg gagattggca ctgaggttag cgggaaaacc       480
     ttgaacagtg ccgacttcga gccgttctgg actgcatgcg aggagttgga tttcccaata       540
     tttgtccacc ctctcggata tgagctcgaa caggagaaca aggaacgatg ggggaagtac       600
     tggtcagcat ggctaatagg aatgcccagc gagacagcgc ttgcaatgca ctctatactc       660
     tcatctggtg ttctggtgcg ccacccgaac ctgcgtttct gcttcgccca cgccggtggg       720
     gcttacttgc cccttctcgg ccgaattcag catggatacg attgtcgtcc tgatctggtt       780
     gcgcacagct cccaaggagt gcttcctcag gactatatcc agtcacagca gcacaacatc       840
     tggctcgaca gtctggtgca tgacccagat ctactgcaat ttatctgcaa gaagattgga       900
     gcggaaagga tcatcatggg cagtgattac ccattcccac tcggcgagat gccagtccca       960
     ggcgagatgc tggccagtga cgcgcaggtg ggcagcttcc tttcacagga gaagcgggcg      1020
     cagatgttgt cagggaacgc cattgaattc cttgggctgg agggcatgtt tcccgggtgt      1080
     aaatag                                                                 1086
//

If you have problems or comments...

PBIL Back to PBIL home page