(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE237

PENCW_16.PE237       Location/Qualifiers
FT   CDS_pept        join(536814..536988,537065..537078,537150..537255,
FT                   537305..537567)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000218448" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947799"
FT                   /orf_name="Pc20g02370"
FT                   /product="Pc20g02370 protein"
FT                   /function="3-hydroxyanthranilate 3,4-dioxygenase activity "
FT                   /function="iron ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP85566.1"
FT                   /db_xref="GO:0000334"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR010329"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniParc:UPI000183175D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HED9"
FT                   /transl_table=1
FT                   /translation="MEHASSAQTSIPGPVTLHSWLSANAQKLQPPVNNQCLYSGKDFIL
FT                   MAVGGPNTRNDYHINQTEEWFYQIKGDMLLKIVENGTCFRDIEIREGEMFLLPGDIPHC
FT                   PIRYEETIGLVMERTRPPHVVDRIRWYCPNADAHRTVPSIIREESFHCADIETQLKDLI
FT                   NHWMTDESTRKCGGCGEIAPPH"
     atggagcacg catcgtccgc tcaaacttct attccgggac ccgttactct gcactcgtgg        60
     ctatccgcga acgcccagaa gttacagccc ccggtcaata atcaatgtct gtattctgga       120
     aaggacttca tcttaatggc agttggaggg ccgaacacga ggaatgacta ccacatcaac       180
     cagacagagg agtggttcta ccaaatcaag ggtgacatgc tgctcaagat tgtcgagaat       240
     ggcacttgct ttcgtgacat tgagattcga gaaggcgaaa tgttccttct gcctggagac       300
     atcccgcatt gcccaatccg gtatgaggaa accattggcc ttgtcatgga gcgcactcgg       360
     cccccgcacg tagtcgaccg cataaggtgg tactgcccca atgcagacgc tcaccggact       420
     gttcccagca tcatccggga agagtcgttc cactgcgctg acatcgaaac gcagcttaag       480
     gatctcatta atcattggat gacggatgaa agtacacgaa agtgcggcgg ctgtggggag       540
     attgcgccgc cgcattga                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page