(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE239

PENCW_16.PE239       Location/Qualifiers
FT   CDS_pept        540948..542402
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048569" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947800"
FT                   /orf_name="Pc20g02390"
FT                   /product="Pc20g02390 protein"
FT                   /protein_id="CAP85568.1"
FT                   /db_xref="InterPro:IPR009770"
FT                   /db_xref="UniParc:UPI0001831835"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEE1"
FT                   /transl_table=1
FT                   /translation="MKSETTSRHHAAPAKIRDAFSRAMSAMYASEVPLYGRLLSLVSRV
FT                   NKTTLEQDGLLRQRLEATDDLDRIDMERHGAIRVGTPAELHSVRRVLHVMNMLPTGFYD
FT                   LSAAGVPVYATCFRPHSASELSKNPFRLFVSLLQLHLITDEKLRTIATETLARRQIFSD
FT                   RMYELLDICERYGGLTDAEAEEFVQEARDSFRWHASAAVPYDDYMRLLRDNSVLADIVA
FT                   FRSPHINHLTPRTLDIDEVQSDMLNQGIPLKEYVEGPPKRKCPILLRQTSFKAIEEAIE
FT                   FPNGNKCDPRVLPSAVSGYHTARFGEVEQRGVALTIKGRQMYDSMLQSALQDGITAAHG
FT                   DAYSLKFARFPDSWEELRAEGLAWFQYRVDWDQLQSSETPKSDDLEYLIRSGYVVYEPI
FT                   VYEDFLPISAAGIFQSNLAKPGTTNGGSPKMVPCSNRREFELALGAATMDEMILYKNIQ
FT                   EESLLKCRQCVQDLKLGAATRQENSM"
     atgaagtccg agaccaccag ccgtcaccac gcggcgccag caaaaatccg tgatgccttc        60
     tccagggcca tgtccgccat gtatgcgtct gaggtccctc tttatggaag actcttgtct       120
     cttgtctctc gtgtcaacaa gacgaccctt gagcaggacg gtttactacg ccagcgcttg       180
     gaagccacag atgacctaga ccgcatcgac atggaacgac atggcgcgat ccgagttggt       240
     acaccggcag aactacattc agtgcgccgc gtgctacacg taatgaacat gctccctact       300
     gggttttacg acctctccgc agcgggcgta ccagtgtatg cgacttgctt ccgccctcat       360
     agcgcatcgg agctatccaa gaatccattt cggctgtttg tttcgctgtt gcagttacac       420
     ctaatcacag atgaaaagct ccgaactatt gccaccgaga ctcttgcccg ccgtcaaata       480
     ttctcagacc ggatgtacga gctgctagac atctgtgagc gctacggtgg ccttacagat       540
     gccgaggctg aggagttcgt ccaggaagcg agggatagct tccgatggca tgctagtgct       600
     gctgttcctt acgacgacta catgcgactc ttgcgcgata attctgtcct agccgatatt       660
     gttgcttttc ggtcaccaca catcaaccat ctcacgcctc gtaccttgga catcgatgag       720
     gtgcagtccg atatgctcaa ccagggtatt ccgctgaagg aatacgtcga aggtccaccg       780
     aaaaggaaat gtcccattct cctacgacaa accagcttca aagccattga ggaggcgatt       840
     gaatttccaa acggaaataa gtgcgacccg agagtattgc ccagtgccgt gtctgggtat       900
     cacacagcca gatttggaga ggtcgagcaa cgaggtgtgg ctttaacaat caaggggcgc       960
     cagatgtacg actcaatgtt gcaatcagcc ttgcaggatg gcattacagc cgcacatgga      1020
     gacgcatatt cccttaaatt cgccagattc cccgactcat gggaggagct acgtgcggag      1080
     ggcctagcgt ggtttcaata ccgtgttgat tgggaccaac tgcaatcgtc agagactccc      1140
     aagtccgatg atctcgagta tctgattaga tctggttacg tggtgtacga gcccatcgtg      1200
     tacgaggatt tcctccctat cagcgcagcg ggcatcttcc agagcaatct tgcaaaacca      1260
     gggacgacca acggcgggtc accaaaaatg gttccttgca gtaacaggcg agagtttgag      1320
     ctcgccctgg gtgcggcaac tatggacgag atgatactat acaagaacat ccaggaagag      1380
     agtcttctga aatgtcgaca atgtgttcaa gaccttaaac tgggagcggc gacaagacag      1440
     gaaaattcga tgtaa                                                       1455
//

If you have problems or comments...

PBIL Back to PBIL home page