(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE242

PENCW_16.PE242       Location/Qualifiers
FT   CDS_pept        join(546638..547738,547804..547938)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824374"
FT                   /orf_name="Pc20g02420"
FT                   /product="Pc20g02420 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP85571.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR006992"
FT                   /db_xref="UniParc:UPI0001831838"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEE4"
FT                   /transl_table=1
FT                   /translation="MDDLSLLRHLIQNHPLIDHHAHNLLNPEPATDYDNYPLEAIATSA
FT                   GGRALENARTTLPSLRAASQLSELYGRPCADWNDVQSAHDESMRGDYSNLIQKSLSGTH
FT                   ALLLDDYLSDDEDIESSSWHDSFTASPTKRIVQIEAMAESTILQVSNSRKNGESVWNNF
FT                   RQRFQDALATAMEDANIVGFVSEICCRTGLDVDAYSSDDTTLGGSLIRILDSGTTKSGF
FT                   AVDDKEICDWIVQQTLKAISFKKRAGIVKPLLFHTGLGDNRINLLRANPACLQPLIAQY
FT                   PVADIVLLNAGYPYTREAGYLAATYPNVYLDLGKVFPMVSREAQMKVLRESLELAPTDR
FT                   LLWSTGGRFHPETFWLANRQFRQALETVLVDYVQNGDFMASQAMKIAADVLFYNANRLY
FT                   SLNLTPSYTAAE"
     atggacgatc ttagtctgct acgacacctg attcagaatc acccgctaat cgaccaccat        60
     gcccataacc tattgaaccc cgagccagcc accgactacg acaattaccc attagaggcc       120
     atcgccacct cagcaggcgg tcgcgcccta gaaaatgccc gcacaaccct cccctcgctg       180
     cgggccgcaa gccagctctc ggagctctac ggccgcccat gtgcagactg gaacgacgtc       240
     caatccgcgc acgatgaaag catgcgcgga gactactcca acttgatcca aaagtctctg       300
     tcaggcacgc acgccctgct actcgatgat tatctcagcg acgacgaaga tatcgaatcc       360
     tcgagctggc acgatagctt tacggcctca ccgacaaagc ggatcgtgca gatcgaagcc       420
     atggccgagt ccacaatctt gcaggtatcg aactcgcgca agaacggcga atcagtctgg       480
     aacaatttcc gtcagcggtt ccaggacgct ctggccacag ccatggaaga cgccaacatt       540
     gttggttttg tatcggaaat ttgctgtcgg accggattgg acgtggatgc gtattcctct       600
     gatgatacca cccttggcgg gtcattgatt cgcatcctcg attccggcac aaccaagtct       660
     gggttcgcgg tcgatgataa ggagatctgt gattggatag tccagcaaac gctgaaagcg       720
     atctcgttta agaaaagagc tggtattgtg aaacctttgc tgtttcacac cggcttggga       780
     gataaccgga ttaatctttt gcgagctaac cctgcatgtc tgcagccttt aatcgcacag       840
     tatcctgtcg cggacattgt gttgttgaat gccggttacc cttacacccg cgaggcgggt       900
     tatctggctg ctacttatcc aaatgtctat cttgatctcg ggaaggtctt tcccatggtt       960
     agccgggagg cgcagatgaa ggtcctgaga gaaagtttgg agctcgcgcc tactgatcgt      1020
     ttgctctgga gtaccggtgg ccggtttcac ccggagacgt tctggttggc taatcgacag      1080
     ttccgccagg ctctggagac ggtactagtg gattacgttc aaaacggcga cttcatggcg      1140
     tcccaggcca tgaagatagc agctgatgtt ctgttctata acgccaatcg tctttacagc      1200
     ctgaacttga ctccatcgta cactgctgcg gagtaa                                1236
//

If you have problems or comments...

PBIL Back to PBIL home page